EGF Human 500 µg

In stock

Cat-Nr.
100-009
Size
500 µg
  €139.00

Description / EGF

Epidermal growth factor (EGF) is the founding member of the EGF family that also includes TGFα, amphiregulin (AR), betacellulin (BTC), epiregulin (EPR), heparin-binding EGF-like growth factor (HBEGF), epigen, and the neuregulins (NRG) 1 through 6. Members of the EGF family share a structural motif, the EGF-like domain, which is characterized by three intra-molecular disulfide bonds that are formed by six similarly spaced conserved cysteine residues. All EGF family members are synthesized as type I transmembrane precursor proteins that may contain several EGF domains in the extracellular region. The mature proteins are released from the cell surface by regulated proteolysis. The 1207 amino acid (aa) human EGF precursor contains nine EGF domains and nine LDLR class B repeats. The mature protein consists of 53 aa and is generated by proteolytic excision of the EGF domain proximal to the transmembrane region. Mature human EGF shares 70% aa sequence identity with mature mouse and rat EGF. EGF is present in various body fluids, including blood, milk, urine, saliva, seminal fluid, pancreatic juice, cerebrospinal fluid, and amniotic fluid. Four ErbB (HER) family receptor tyrosine kinases including EGFR/ErbB1, ErbB2, ErbB3 and ErbB4, mediate responses to EGF family members. EGF binds ErbB1 and depending on the context, induces the formation of homodimers or heterodimers containing ErbB2. Biological activities ascribed to EGF include epithelial development, angiogenesis, inhibition of gastric acid secretion, fibroblast proliferation, and colony formation of epidermal cells in culture.

More Information

Size 500 µg
Source E. coli
Biological Activity The biological activity was determined by the ability to induce EGF receptor phosphorylation in the A431 tumor cell line [Soler et al, J Chromatography B, 788, 2003] and the induction of proliferation in NHDF cells (Normal Human Dermal Fibroblasts).
N Terminal Sequence MNSDSECPLS
Purity Confirmation > 95% by SDS-PAGE
Length [aa] 54
Molecular Weight 6.35 kDa
Species Reactivity human, mouse
Formulation lyophilized
Buffer PBS
Protein Sequence MNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
Reconstitution We recommend a quick spin followed by reconstitution in water to a concentration of 0.1-1.0 mg/ml.
Stability and Storage The lyophilized protein is stable for a few weeks at room temperature, but best stored at -20°C. Reconstituted EGF should be stored in working aliquots at -20°C.
Synonyms Epidermal growth factor; EGF; URG; HOMG4; Urogastrone
Uniprot ID P01133
Protein RefSeq NP_001954.2
mRNA RefSeq NM_1963.4
Adult stem cells-derived organoids Endometrium, Fallopian tube, Gallbladder, Intestine, Kidney tubule, Liver, Mammary, Oesophagus, Oral mucosa, Pancreatic duct, Stomach
Pluripotent stem cells-derived organoids Esophagus, Intestine, Liver, Stomach

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.
SKU: 101-M385
€533.00

In stock

SKU: 101-M616
€533.00

In stock

SKU: 102-P06
€271.00

In stock

SKU: 102-PA10
€310.00

In stock

All prices plus VAT + possible delivery charges