human EGF(Animal Free) protein Human 1000 µg

In stock

Cat-Nr.
100-009-L1000-AF
Size
1000 µg
€267.00

Description / human EGF(Animal Free) protein

EGF is a potent growth factor that stimulates the proliferation of various epidermal and epithelial cells. Additionally, EGF has been shown to inhibit gastric secretion, and to be involved in wound healing. EGF signals through a receptor known as c-erbB, which is a class I tyrosine kinase receptor. This receptor also binds with TGF-α and VGF (vaccinia virus growth factor). Recombinant Human EGF is a 6.2 kDa globular protein containing 53 amino acid residues, including 3 intramolecular disulfide bonds.

More Information

Size 1000 µg
Source E. coli
Biological Activity The biological activity was determined by the ability to induce EGF receptor phosphorylation in the A431 tumor cell line [Soler et al, J Chromatography B, 788, 2003] and the induction of proliferation in NHDF cells (Normal Human Dermal Fibroblasts).
N Terminal Sequence MNSDSECPLS
Purity Confirmation > 95% by SDS-PAGE
Length [aa] 54
Molecular Weight 6.35 kDa
Species Reactivity Chicken, Cow, Dog, Hamster, Horse, Human, Human + Hamster, Monkey, Mouse, Pig, Rabbit, Rat, Salamander, Snake, Tunicate, Zebra Fish
Formulation lyophilized
Protein Sequence MNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
Synonyms Epidermal growth factor; EGF; URG; HOMG4; Urogastrone
Uniprot ID P01133
Protein RefSeq NP_001954.2
mRNA RefSeq NM_1963.4
Adult stem cells-derived organoids Endometrium, Fallopian tube, Gallbladder, Intestine, Kidney tubule, Liver, Mammary, Oesophagus, Oral mucosa, Pancreatic duct, Stomach
Pluripotent stem cells-derived organoids Esophagus, Intestine, Liver, Stomach

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.
SKU: 101-M385
€453.00

In stock

SKU: 101-M616
€453.00

In stock

SKU: 102-PA10
€316.00

In stock

All prices plus VAT + possible delivery charges