human EGF(Animal Free) protein Human 1000 µg
Description / human EGF(Animal Free) protein
EGF is a potent growth factor that stimulates the proliferation of various epidermal and epithelial cells. Additionally, EGF has been shown to inhibit gastric secretion, and to be involved in wound healing. EGF signals through a receptor known as c-erbB, which is a class I tyrosine kinase receptor. This receptor also binds with TGF-α and VGF (vaccinia virus growth factor). Recombinant Human EGF is a 6.2 kDa globular protein containing 53 amino acid residues, including 3 intramolecular disulfide bonds.
More Information
| Size | 1000 µg |
|---|---|
| Source | E. coli |
| Biological Activity | The biological activity was determined by the ability to induce EGF receptor phosphorylation in the A431 tumor cell line [Soler et al, J Chromatography B, 788, 2003] and the induction of proliferation in NHDF cells (Normal Human Dermal Fibroblasts). |
| N Terminal Sequence | MNSDSECPLS |
| Purity Confirmation | > 95% by SDS-PAGE |
| Length [aa] | 54 |
| Molecular Weight | 6.35 kDa |
| Species Reactivity | Chicken, Cow, Dog, Hamster, Horse, Human, Human + Hamster, Monkey, Mouse, Pig, Rabbit, Rat, Salamander, Snake, Tunicate, Zebra Fish |
| Formulation | lyophilized |
| Protein Sequence | MNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR |
| Synonyms | Epidermal growth factor; EGF; URG; HOMG4; Urogastrone |
| Uniprot ID | P01133 |
| Protein RefSeq | NP_001954.2 |
| mRNA RefSeq | NM_1963.4 |
| Adult stem cells-derived organoids | Endometrium, Fallopian tube, Gallbladder, Intestine, Kidney tubule, Liver, Mammary, Oesophagus, Oral mucosa, Pancreatic duct, Stomach |
| Pluripotent stem cells-derived organoids | Esophagus, Intestine, Liver, Stomach |

