human VEGF206 protein Human 20 µg

Cat-Nr.
300-099
Size
20 µg
€214.00

Description / human VEGF206 protein

Vascular endothelial growth factor-A (VEGF-A) mRNA undergoes alternative splicing events that generate several different homodimeric isoforms, e.g. VEGF121, VEGF145, VEGF165, VEGF189, and VEGF206. VEGF121 is a non-heparin-binding acidic protein, which is freely diffusible. The longer forms, VEGF189 or VEGF206, are highly basic proteins tightly bound to extracellular heparin-containing proteoglycans. VEGF165 has intermediate properties. VEGF165 was observed largely in Golgi apparatus-like structures. Immunogold labeling of cells expressing VEGF189 or VEGF206 revealed that the staining was localized to the subepithelial ECM. VEGF associated with the ECM was bioactive, because endothelial cells cultured on ECM derived from cells expressing VEGF189 or VEGF2O6 were markedly stimulated to proliferate. In addition, ECM-bound VEGF can be released into a soluble and bioactive form by heparin or plasmin. ECM-bound VEGF189 and VEGF206 have molecular masses consistent with the intact polypeptides. The ECM may represent an important source of VEGF and angiogenic potential. The isoforms VEGF145, VEGF165 and VEGF189 bind to heparin with high affinity, the affinity of VEGF206 is much weaker. All dimeric forms have similar biological activities but their bio­availability is very different. However so far there are only a few data about the biological activities of VEGF206.

Available sizes:

No. Size [µg]
300-098S 2
300-098 5
300-099 20

 

More Information

Size 20 µg
Source E. coli
Biological Activity The ED50 for stimulation of cell proliferation in human dermal lymphatic endothelial cells (HDLEC) by VEGF206 has been determined to be in the range of 5-15 ng/ml.
N Terminal Sequence APMAEGG
Purity Confirmation > 75% by SDS-PAGE
Endotoxin < 0.1 ng/µg of protein (< 1 EU/µg)
Length [aa] 206
Molecular Weight approx. 47 kDa (Dimer)
Species Reactivity Human
Formulation lyophilized
Buffer 50mM acetic acid
Protein Sequence APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPGPHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Reconstitution The lyophilized VEGF206 should be reconstituted in 50mM acetic acid to a concentration not lower than 50 µg/ml. For long term storage we recommend to add at least 0.1% human or bovine serum albumin.
Stability and Storage The lyophilized protein is stable for a few weeks at room temperature, but best stored at -20°C. Reconstituted VEGF206 should be stored in working aliquots at –20°C. Avoid repeated freeze-thaw cycles.
Synonyms vascular endothelial growth factor A; VEGFA;VPF; VEGF; MVCD3
Uniprot ID P15692
Protein RefSeq NP_001020537.2
mRNA RefSeq NM_001025366.2
Pluripotent stem cells-derived organoids Blood vessel

All prices plus VAT + possible delivery charges