human VEGF189 protein Human 20 µg

Cat-Nr.
300-095
Size
20 µg
€214.00

Description / human VEGF189 protein

Vascular Endothelial Growth Factor VEGF189, a 21 kDa protein consisting of 189 amino acid residues, is produced as a homodimer. VEGF is a polypeptide growth factor and a member of the platelet-derived growth factor family. It is a specific mitogen for vascular endothelial cells and a strong angiogenic factor in vivo. Two high-affinity tyrosine kinase receptors for VEGF165 have been identified, VEGFR-1 (FLT-1), and VEGFR-2 (KDR). Consistent with the endothelial cell-specific action of VEGF165, expression of both receptor genes has been found predominantly but not exclusively on endothelial cells. Expression of VEGFR-1 was also found on human monocytes, neutrophils (PMNs), bovine brain pericytes and villous and extravillous trophoblasts. In addition to its action as a mitogen it is a potent vascular permeability factor (VPF) in vivo. VEGF165 is also a chemoattractant molecule for monocytes and endothelial cells. 5 different proteins are generated by differential splicing: VEGF121, VEGF145, VEGF165, VEGF189 and VEGF206. The most abundant form is VEGF165. Whereas VEGF121 and VEGF165 are secreted proteins, VEGF145, VEGF189 and VEGF206 are strongly cell-associated. The isoforms VEGF145, VEGF165 and VEGF189 bind to heparin with high affinity. VEGF165 is apparently a homodimer, but preparations of VEGF165 show some heterogeneity on SDS gels, depending on the secretion of different glycosylation patterns. All dimeric forms have similar biological activities but their bioavailability is very different. There is good evidence that heterodimeric molecules between the different isoforms also exists and that different cells and tissues express different VEGF isoforms. The other members of this increasing growth factor family are VEGF-B, -C, -D and -E. Another member is the Placenta growth factor PlGF.

Available sizes:

No. Size [µg]
300-094S 2
300-094 5
300-095 20

 

More Information

Size 20 µg
Source E. coli
Biological Activity Measured by the stimulation of cell proliferation in human umbilical vein endothelial cells in the range of 2-20 ng/ml.
N Terminal Sequence APMAEGG
Purity Confirmation > 90% by SDS-PAGE
Endotoxin < 0.1 ng/µg of protein (< 1 EU/µg)
Length [aa] 189
Molecular Weight ~ 42.0 kDa
Species Reactivity Human
Formulation lyophilized
Buffer 50mM acetic acid
Protein Sequence APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Reconstitution The lyophilized VEGF189 is soluble in water and most aqueous buffers. The lyophilized VEGF189 should be reconstituted in PBS or medium containing at least 0.1% human or bovine serum albumin to a concentration not lower than 50µg/ml.
Stability and Storage The lyophilized protein is stable for a few weeks at room temperature, but best stored at -20°C. Reconstituted VEGF189 should be stored in working aliquots at –20°C. Avoid repeated freeze-thaw cycles.
Synonyms vascular endothelial growth factor A; VEGFA;VPF; VEGF; MVCD1
Uniprot ID P15692
Protein RefSeq NP_001020537.2
mRNA RefSeq NM_001025366.2
Pluripotent stem cells-derived organoids Blood vessel

All prices plus VAT + possible delivery charges