human VEGF165b protein Human 20 µg

Cat-Nr.
300-082
Size
20 µg
€214.00

Description / human VEGF165b protein

Vascular endothelial growth factor-A (VEGF-A) is a potent mediator of both angiogenesis and vasculogenesis in the fetus and adult. Humans express two sets of alternately spliced isoforms of 121, 145, 165, 183, 189, and 206 amino acids. VEGF165 appears to be the most abundant and potent of the angiogenic isoform set, followed by VEGF121 and VEGF189. The anti-angiogenic or “b” set of isoforms is differentially spliced to contain six alternate amino acids at the C-terminus, and are the more highly expressed isoforms in normal adult tissue. VEGF165b, like VEGF121 but unlike most angiogenic isoforms, does not bind heparins and is therefore diffusible. VEGFs bind the type I transmembrane receptor tyrosine kinases VEGFR1 (Flt1) and VEGFR2 (Flk1/KDR) on endothelial cells. Although VEGF affinity is highest for binding to Flt1, KDR appears to be the primary mediator of VEGF angiogenic activity. The affinity of VEGF165b for KDR is similar to that of VEGF165, but VEGF165b only partially activates KDR such that the kinase regulatory site Y1054 is not phosphorylated. VEGF165b also does not bind Neuropilin-1, suggesting that the functional difference between VEGF165 and VEGF165b may be due to either the lack of Neuropilin-1 co-signaling or unique downstream signaling activated by VEGF165b. Since VEGF165b may compete with angiogenic VEGFs for KDR sites, its ectopic expression in tumors has been shown to inhibit their growth.

Available sizes:

No. Size [µg]
300-081 5
300-082 20

 

More Information

Size 20 µg
Source E. coli
Biological Activity Measured by its binding ability in a functional ELISA: Recombinant human sKDR and sKDR(D7)/Fc were coated to the plate (1μg/ml) and rhVEGF165 and rhVEGF165b were added. Bound VEGF165 and VEGF165b were detected by an anti-human VEGF-A antibody.
N Terminal Sequence APMAEGG
Endotoxin < 0.1 ng/µg of protein (< 1 EU/µg)
Length [aa] 165
Molecular Weight 38.2 kDa
Species Reactivity Human
Formulation lyophilized
Buffer 50mM acetic acid
Protein Sequence APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRSLTRKD
Reconstitution The lyophilized VEGF165 should be reconstituted in 50 mM acetic acid to a concentration not lower than 50 µg/ml. For long term storage we recommend to add at least 0.1% human or bovine serum albumin.
Stability and Storage Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted VEGF165 should be stored in working aliquots at -20°C.
Synonyms vascular endothelial growth factor A; VEGFA; VPF; VEGF; MVCD1
Uniprot ID P15692-8
Protein RefSeq NP_001165100.1
mRNA RefSeq NM_001171629.1
Pluripotent stem cells-derived organoids Blood vessel

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.

All prices plus VAT + possible delivery charges