rat VEGF120 protein Rat 2 µg

Cat-Nr.
R20-063S
Size
2 µg
€88.00

Description / rat VEGF120 protein

Rat Vascular Endothelial Growth Factor120 (VEGF120), a 14.1 kDa protein consisting of 120 amino acid residues, is produced as a homodimer. VEGF120 is a polypeptide growth factor and a member of the platelet-derived growth factor family. It is a specific mitogen for vascular endothelial cells and a strong angiogenic factor in vivo. Two high-affinity tyrosine kinase receptors for VEGF120 have been identified, VEGFR-1 (FLT-1), and VEGFR-2 (Flk-1). Consistent with the endothelial cell-specific action of VEGF120, expression of both receptor genes has been found predominantly but not exclusively on endothelial cells. Expression of VEGFR-1 was also found on human monocytes, neutrophils (PMNs), bovine brain pericytes and villous and extravillous trophoblasts. In addition to its action as a mitogen it is a potent vascular permeability factor (VPF) in vivo and is also a chemo attractant for monocytes and endothelial cells. At least four different proteins are generated by differential splicing of the mouse VEGF gene: VEGF120, VEGF144, VEGF164 and VEGF188. The most abundant form is VEGF164. Whereas VEGF120, VEGF144 and VEGF164 are secreted proteins, VEGF188 is strongly cell-associated. In addition, the isoforms VEGF164 and VEGF188 bind to heparin with high affinity. All dimeric forms possess similar biological activities. A related protein of VEGF is placenta growth factor (PlGF) with about 53% homology and VEGF-B with similar biological activities. The full ORF of native rat VEGF120 (Ala27-Arg146) was cloned from total RNA of rat sinusoidal endothelial cells using standard protocols.

More Information

Size 2 µg
Source E. coli
Biological Activity Determined by the dose-dependent stimulation of the proliferation of human umbilical vein endothelial cells (HUVEC) using a concentration range of 2-10 ng/ml.
N Terminal Sequence APTTEGEQKAH
Purity Confirmation > 90% by SDS-PAGE
Length [aa] 120
Molecular Weight 14.02 kDa
Species Reactivity Rat
Formulation lyophilized (freeze-dried)
Buffer PBS
Protein Sequence APTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKCDKPRR
Reconstitution The lyophilized VEGF120 should be reconstituted in ddH2O to a concentration not lower than 50µg/ml.
Stability and Storage Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted VEGF120 should be stored in working aliquots at -20°C.
Synonyms Vascular Endothelial Growth Factor A; Vegfa; Vegf; VEGF120
Uniprot ID P16612
Protein RefSeq NP_114024.2.
mRNA RefSeq NM_031836.2

All prices plus VAT + possible delivery charges