human VEGF-C protein (His-Tag) Human 5 µg

In stock

Cat-Nr.
300-078
Size
5 µg
  €88.00

Description / human VEGF-C protein (His-Tag)

VEGF-C, also known as Vascular Endothelial Growth Factor Related Protein (VRP), is a recently discovered VEGF growth factor family member that is most closely related to VEGF-D. The human VEGF-C cDNA encodes a pre-pro-protein of 416 amino acids residues. It is almost identical to the mouse VEGF-C protein. Similar to VEGF-D, VEGF-C has a VEGF homology domain spanning the middle third of the precursor molecule and long N- and C-terminal extensions. In adults, VEGF-C is highly expressed in heart, placenta, ovary and small intestine. Recombinant human VEGF-C, lacking the N- and C-terminal extensions and containing only the middle VEGF homology domain, forms primarily non-covalently linked dimers. This protein is a ligand for both VEGFR-2/KDR and VEGFR-3/FLT-4. Since VEGFR-3 is strongly expressed in lymphatic endothelial cells, it has been postulated that VEGF-C is involved in the regulation of the growth and/or differentiation of lymphatic endothelium. Although recombinant human VEGF-C is also a mitogen for vascular endothelial cells, it is much less potent than VEGF-A. The recombinant human VEGF-C contains 121 amino acids residues and was fused to a His-tag (6x His) at the C-terminal end. As a result of glycosylation VEGF-C migrates as an 18-24 kDa protein in SDS-PAGE under reducing conditions.

More Information

Size 5 µg
Source Insect cells
Biological Activity The biological activity was determined (i) by the ability to induce VEGFR-3/FLT-4 receptor phosphorylation in PAEC/VEGFR-3 cells and (ii) the VEGF-C-induced proliferation of primary human dermal lymphatic endothelial cells (HDLEC).
N Terminal Sequence DPTEETI
Purity Confirmation > 90% by SDS-PAGE
Length [aa] 121
Molecular Weight 18.0-24.0 kDa
Species Reactivity Human
Formulation lyophilized
Buffer Water
Protein Sequence DPTEETIKFAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLHHHHHH
Reconstitution The lyophilized VEGF-C is soluble in water and most aqueous buffers. The lyophilized VEGF-C should be reconstituted in PBS or medium to a concentration not lower than 50 µg/ml.
Stability and Storage Lyophilized samples are stable for more than six months at -20°C to -70°C. Reconstituted VEGF-C should be stored in working aliquots at -20°C. Avoid repeated freeze-thaw cycles.
Synonyms vascular endothelial growth factor C; VEGFC; VRP; Flt4-L; VEGF c
Uniprot ID P49767
Protein RefSeq NP_005420.1
mRNA RefSeq NM_005429.2
Pluripotent stem cells-derived organoids Lymph vessel

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.
SKU: 101-M88
€193.00

In stock

SKU: 101-M89
€193.00

In stock

SKU: 101-M90
€193.00

In stock

SKU: 101-M91
€193.00

In stock

All prices plus VAT + possible delivery charges