mouse TIE-2, soluble protein (His-Tag) Mouse 50 µg

In stock

Cat-Nr.
S01-M44
Size
50 µg
  €214.00

Description / mouse TIE-2, soluble protein (His-Tag)

Recombinant mouse soluble TIE-2 was fused with a 6x His-tag at the C-terminus. The soluble receptor protein consists of the full extracellular domain (Ala23-Ala737). Mouse sTIE-2 monomer has a calculated molecular mass of approximately 79,86 kDa. As a result of glycosylation, the recombinant protein migrates as an approximately 95 kDa protein in SDS-PAGE under reducing conditions. TIE-1 (tyrosine kinase with Ig and EGF homology domains 1) and TIE-2/Tek comprise a receptor tyrosine kinase (RTK) subfamily with unique structural characteristics: two immunoglobulin-like domains flanking three epidermal growth factor (EGF)-like domains and followed by three fibronectin type III-like repeats in the extracellular region and a split tyrosine kinase domain in the cytoplasmic region. These receptors are expressed primarily on endothelial and hematopoietic progenitor cells and play critical roles in angiogenesis, vasculogenesis and hematopoiesis.

More Information

Size 50 µg
Source Insect cells
Biological Activity Testing under progress.
N Terminal Sequence AMDLILINSL
Purity Confirmation > 95% by SDS-PAGE
Length [aa] 712
Species Reactivity Mouse
Formulation lyophilized
Buffer PBS
Protein Sequence AMDLILINSLPLVSDAETLTCIASGWHPHEPITIGRDFEALMNQHQDPLEVTQDVTREWAKKVVWKREKASKINGAYCEGRVRGQAIRIRTMKMRQQASFLPATLTMTVDRGDNVNISFKKVLIKEEDAVIYKNGSIHSVPRHEVPDILEVHLPHAQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPDCRPCTTCKNNGVCHEDTGECICPPGFMGRTCEKACEPHTFGRTCKERCSGPEGCKSYVFCP
Reconstitution Centrifuge vial prior to opening. The lyophilized sTIE-2-His is soluble in water and most aqueous buffers and should be reconstituted in PBS or medium to a concentration not lower than 50µg/ml.
Stability and Storage Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted sTIE-2-His should be stored in working aliquots at -20°C.
Synonyms Angiopoietin-1 receptor; Endothelial tyrosine kinase; HYK; STK1; Tunica interna endothelial cell kinase; Tyrosine kinase with Ig and EGF homology domains-2; Tyrosine-protein kinase receptor TEK; Tyrosine-protein kinase receptor TIE-2; p140 TEK; CD202b; Te
Uniprot ID Q02858
Protein RefSeq NP_038718.2
mRNA RefSeq NM_013690.2

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.
SKU: 103-PA111
€316.00

In stock

SKU: 103-M55
€453.00

In stock

SKU: mT1002r-m
€649.00

In stock

All prices plus VAT + possible delivery charges