human TIE-1/Fc Chimera, soluble protein Human 100 µg

In stock

Cat-Nr.
SFC-012
Size
100 µg
€214.00

Description / human TIE-1/Fc Chimera, soluble protein

Recombinant human soluble TIE-1 was fused with the Fc part of human IgG1. The soluble receptor protein consists of the full extracellular domain (Met1-Glu749). The recombinant mature TIE-1/Fc is a disulfide-linked homodimeric protein. Human TIE-1/Fc monomer has a calculated molecular mass of approximately 105 kDa. As a result of glycosylation, the recombinant protein migrates as an approximately 125 kDa protein in SDS-PAGE under reducing conditions.TIE-1 (tyrosine kinase with Ig and EGF homology domains 1) and TIE-2/Tek comprise a receptor tyrosine kinase (RTK) subfamily with unique structural characteristics: two immunoglobulin-like domains flanking three epidermal growth factor (EGF)-like domains and followed by three fibronectin type III-like repeats in the extracellular region and a split tyrosine kinase domain in the cytoplasmic region. These receptors are expressed primarily on endothelial and hematopoietic progenitor cells and play critical roles in angiogenesis, vasculogenesis and hematopoiesis. Human TIE-1 cDNA encodes a 1124 amino acid (aa) residue precursor protein with an 18 residue putative signal peptide, a 727 residue extracellular domain and a 354 residue cytoplasmic domain. Whereas two ligands have been described for TIE-2 [angiopoietin-1 (Ang1) and angiopoietin-2 (Ang2)], so far no ligand was found for TIE-1.

More Information

Size 100 µg
Source Insect cells
Biological Activity Bioassay data are not available.
N Terminal Sequence VDLTLLA
Purity Confirmation > 90% by SDS-PAGE
Length [aa] 957
Molecular Weight 240 kDa
Species Reactivity Human
Formulation lyophilized
Buffer PBS
Protein Sequence VDLTLLANLRLTDPQRFFLTCVSGEAGAGRGSDAWGPPLLLEKDDRIVRTPPGPPLRLARNGSHQVTLRGFSKPSDLVGVFSCVGGAGARRTRVIYVHNSPGAHLLPDKVTHTVNKGDTAVLSARVHKEKQTDVIWKSNGSYFYTLDWHEAQDGRFLLQLPNVQPPSSGIYSATYLEASPLGSAFFRLIVRGCGAGRWGPGCTKECPGCLHGGVCHDHDGECVCPPGFTGTRCEQACREGRFGQSCQEQCPGISG
Reconstitution Centrifuge vial prior to opening. The lyophilized sTIE-1-His is soluble in water and most aqueous buffers and should be reconstituted in PBS to a concentration not lower than 50µg/ml.
Stability and Storage Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted sTIE-1/Fc should be stored in working aliquots at -20°C.
Synonyms TIE1; TIE; JTK14
Uniprot ID P35590
Protein RefSeq NP_005415
mRNA RefSeq NM_005424

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.
SKU: 101-M47
€453.00

In stock

SKU: 101-M46
€193.00

In stock

SKU: 101-M48
€193.00

In stock

All prices plus VAT + possible delivery charges