human TIE-1/Fc Chimera, soluble protein Human 20 µg
Description / human TIE-1/Fc Chimera, soluble protein
Recombinant human soluble TIE-1 was fused with the Fc part of human IgG1. The soluble receptor protein consists of the full extracellular domain (Met1-Glu749). The recombinant mature TIE-1/Fc is a disulfide-linked homodimeric protein. Human TIE-1/Fc monomer has a calculated molecular mass of approximately 105 kDa. As a result of glycosylation, the recombinant protein migrates as an approximately 125 kDa protein in SDS-PAGE under reducing conditions. TIE-1 (tyrosine kinase with Ig and EGF homology domains 1) and TIE-2/Tek comprise a receptor tyrosine kinase (RTK) subfamily with unique structural characteristics: two immunoglobulin-like domains flanking three epidermal growth factor (EGF)-like domains and followed by three fibronectin type III-like repeats in the extracellular region and a split tyrosine kinase domain in the cytoplasmic region. These receptors are expressed primarily on endothelial and hematopoietic progenitor cells and play critical roles in angiogenesis, vasculogenesis and hematopoiesis. Human TIE-1 cDNA encodes a 1124 amino acid (aa) residue precursor protein with an 18 residue putative signal peptide, a 727 residue extracellular domain and a 354 residue cytoplasmic domain. Whereas two ligands have been described for TIE-2 [angiopoietin-1 (Ang1) and angiopoietin-2 (Ang2)], so far no ligand was found for TIE-1.
More Information
| Size | 20 µg |
|---|---|
| Source | Insect cells |
| Biological Activity | Bioassay data are not available. |
| N Terminal Sequence | VDLTLLA |
| Purity Confirmation | > 90% by SDS-PAGE |
| Length [aa] | 957 |
| Molecular Weight | 240 kDa |
| Species Reactivity | Human |
| Formulation | lyophilized |
| Buffer | PBS |
| Protein Sequence | VDLTLLANLRLTDPQRFFLTCVSGEAGAGRGSDAWGPPLLLEKDDRIVRTPPGPPLRLARNGSHQVTLRGFSKPSDLVGVFSCVGGAGARRTRVIYVHNSPGAHLLPDKVTHTVNKGDTAVLSARVHKEKQTDVIWKSNGSYFYTLDWHEAQDGRFLLQLPNVQPPSSGIYSATYLEASPLGSAFFRLIVRGCGAGRWGPGCTKECPGCLHGGVCHDHDGECVCPPGFTGTRCEQACREGRFGQSCQEQCPGISG |
| Reconstitution | Centrifuge vial prior to opening. The lyophilized sTIE-1-His is soluble in water and most aqueous buffers and should be reconstituted in PBS to a concentration not lower than 50µg/ml. |
| Stability and Storage | Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted sTIE-1/Fc should be stored in working aliquots at -20°C. |
| Synonyms | TIE1; TIE; JTK14 |
| Uniprot ID | P35590 |
| Protein RefSeq | NP_005415 |
| mRNA RefSeq | NM_005424 |

