Description / mouse Lyve-1, soluble protein (His-Tag)
A DNA sequence encoding the extracellular domain of mouse LYVE-1 (Met1 – Gly228) was fused to a C-terminal His-tag (6xHis) and expressed in insect cells. Based on N-terminal sequence analysis, the primary structure of recombinant mature sLYVE-1 starts at Ala24. sLYVE-1 has a calculated monomeric molecular mass of about 25 kDa but as a result of glycosylation, migrates at approximately 35 - 45 kDa under reducing conditions in SDS-PAGE. LYVE-1 has been identified as a major receptor for HA (extracellular matrix glycosaminoglycan hyaluronan) on the lymph vessel wall. The deduced amino acid sequence of LYVE-1 predicts a 322-residue type I integral membrane polypeptide 41% similar to the CD44 HA receptor with a 212-residue extracellular domain containing a single Link module the prototypic HA binding domain of the Link protein superfamily. Like CD44, the LYVE-1 molecule binds both soluble and immobilized HA. However, unlike CD44, the LYVE-1 molecule colocalizes with HA on the luminal face of the lymph vessel wall and is completely absent from blood vessels. Hence, LYVE-1 is the first lymph-specific HA receptor to be characterized and is a uniquely powerful marker for lymph vessels themselves.
More Information
| Size | 20 µg |
|---|---|
| Source | Insect cells |
| Biological Activity | Not tested so far! |
| N Terminal Sequence | ADLVQDLS |
| Purity Confirmation | > 95% by SDS-PAGE |
| Length [aa] | 211 |
| Molecular Weight | ~ 35.0 - 45.0 kDa |
| Species Reactivity | Mouse |
| Formulation | lyophilized |
| Buffer | PBS |
| Protein Sequence | ADLVQDLSISTCRIMGVALVGRNKNPQMNFTEANEACKMLGLTLASRDQVESAQKSGFETCSYGWVGEQFSVIPRIFSNPRCGKNGKGVLIWNAPSSQKFKAYCHNSSDTWVNSCIPEIVTTFYPVLDTQTPATEFSVSSSAYLASSPDSTTPVSATTRAPPLTSMARKTKKICITEVYTEPITMATETEAFVASGAAFKNEAAGHHHHHH |
| Reconstitution | The lyophilized sLYVE-1 is soluble in water and most aqueous buffers. The lyophilized sLYVE-1 should be reconstituted in PBS or medium to a concentration not lower than 50 µg/ml. |
| Stability and Storage | Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted sLYVE-1 should be stored in working aliquots at -20°C. Avoid repeated freeze-thaw cycles! |
| Synonyms | Lyve1; Xlkd1; Lyve-1; Crsbp-1; 1200012G08Rik |
| Uniprot ID | Q8BHC0 |
| Protein RefSeq | NP_444477 |
| mRNA RefSeq | NM_053247 |

