human FGFR-3(IIIa)/Fc Chimera, soluble protein Human 5 µg

In stock

Cat-Nr.
SFC-023
Size
5 µg
€88.00

Description / human FGFR-3(IIIa)/Fc Chimera, soluble protein

The Fibroblast growth factor receptors (FGFRs) are a family of receptor tyrosine kinases that play key roles in proliferation, differentiation, and tumorigenesis. The FGFR3(IIIb) isoform was identified as the major family member expressed in normal human urothelium. Already in 2005 a splice variant, FGFR3ΔTM, lacking exons encoding the COOH-terminal half of immunoglobulin-like domain III and the transmembrane domain was described. Previous reports had assumed that this is would be a cancer-specific splice variant but in 2005 it was shown that FGFR3ΔTM is a normal transcript in NHU cells and is translated, N-glycosylated, and secreted. Primary urothelium expressed high levels of FGFR3ΔTM transcripts. In culture, levels were reduced in actively proliferating cells but increased at confluence and as cells approached senescence. Cells overexpressing FGFR3 IIIb showed FGF1-induced proliferation, which was inhibited by the addition of FGFR3ΔTM. In bladder tumor cell lines derived from aggressive carcinomas, there were significant alterations in the relative expression of isoforms including an overall decrease in the proportion of FGFR3ΔTM and predominant expression of FGFR3 IIIc in some cases. In summary, alternative splicing of FGFR3 IIIb in NHU cells represents a normal mechanism to generate a transcript that regulates proliferation and in bladder cancer, the ratio of FGFR3 isoforms is significantly altered.

Available sizes:

No. Size [µg]
SFC-023 5
SFC-024 20

 

More Information

Size 5 µg
Source Insect cells
Biological Activity Measured by its binding ability to FGF-2 in a functional ELISA. Recombinant human soluble FGFR3(IIIa)/Fc Chimera binds to immobilized recombinant human FGF-2 (Cat #300-001).
Purity Confirmation > 80% by SDS-PAGE
Length [aa] 518
Molecular Weight 77 kDa
Species Reactivity Human
Formulation lyophilized
Protein Sequence ESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCHFSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKV
Synonyms Fibroblast growth factor receptor 3, FGFR-3/ CD333
Uniprot ID P22607-3
Protein RefSeq NP_075254.1
mRNA RefSeq NM_022965.3

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.
SKU: 101-M417
€510.00

In stock

SKU: 101-M735
€453.00

In stock

All prices plus VAT + possible delivery charges