mouse FGF-2 (basic) protein Mouse 50 µg

In stock

Cat-Nr.
M30-015
Size
50 µg
€214.00

Description / mouse FGF-2 (basic) protein

FGF basic (FGF2, HBGF2) is one of at least 23 mitogenic proteins of the FGF family, which show 35-60% amino acid conservation (1-3). Unlike other FGFs, FGF acidic and basic lack signal peptides and are secreted by an alternate pathway. Storage pools within the cell or on cell surface heparan sulfate proteoglycans (HSPG) are likely. The predicted 17 kDa FGF basic isoform can be located in both the cytoplasm and the nucleus and is presumed to be the form secreted (4). Transcription from alternate start sites produces 21-24 kDa forms found only in the nucleus. High and low molecular weight human FGF basic targets the expression of different genes when expressed in NIH3T3 cells (5). The 17 kDa mouse sequence has 98% aa identity with rat, and 95% identity with human, bovine and sheep FGF basic (6,7). Autocrine, intracrine and paracrine actions of FGF basic have been identified. Binding of FGF to heparin or cell surface HSPG is necessary for binding, dimerization and activation of tyrosine kinase FGF receptors. FGF basic binds other proteins, polysaccharides and lipids with lower affinity (3). Expression of FGF basic is nearly ubiquitous but disruption of the mouse FGF basic gene gives a relatively mild phenotype, suggesting compensation by other FGF family members. FGF basic modulates such normal processes as angiogenesis, wound healing and tissue repair, embryonic development and differentiation, neuronal function and neural degeneration. Transgenic overexpression of FGF basic results in excessive proliferation and angiogenesis reminiscent of a variety of pathological conditions (1-3).

More Information

Size 50 µg
Source E. coli
Biological Activity The ED50 for stimulation of cell proliferation by human umbilical vein endothelial cells for mouse FGF-2 has been determined to be in the range of 0.1-2 ng/ml.
N Terminal Sequence ALPEDDGG
Purity Confirmation > 98% by SDS-PAGE
Endotoxin < 0.1 ng/µg of protein (< 1 EU/µg)
Length [aa] 144
Molecular Weight 16.35 kDa
Species Reactivity Mouse
Formulation lyophilized
Buffer PBS
Protein Sequence ALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Reconstitution The lyophilized basic FGF should be reconstituted in water containing at least 0.1% human or bovine serum albumin to a concentration not lower than 10µg/ml.
Stability and Storage Lyophilized samples are stable for greater than six months at -20°C to -70°C. Basic FGF can be stored in high-salt buffer (PBS, 1M NaCl) at 4°C for 2-4 weeks.
Synonyms Fgf2; Fgfb; bFGF; Fgf-2
Uniprot ID P15655
Protein RefSeq NP_032032.1
mRNA RefSeq NM_008006.2

All prices plus VAT + possible delivery charges