human FGF-2 (basic) protein Human 25 µg

Cat-Nr.
300-002
Size
25 µg
€136.00

Description / human FGF-2 (basic) protein

FGF basic (FGF2, HBGF2) is one of at least 23 mitogenic proteins of the FGF family, which show 35-60% amino acid conservation. Unlike other FGFs, FGF acidic and basic lack signal peptides and are secreted by an alternate pathway. Storage pools within the cell or on cell surface heparan sulfate proteoglycans (HSPG) are likely. The predicted 17 kDa FGF basic isoform can be located in both the cytoplasm and the nucleus and is presumed to be the form secreted. Transcription from alternate start sites produces 21-24 kDa forms found only in the nucleus. High and low molecular weight human FGF basic targets the expression of different genes when expressed in NIH3T3 cells. The 17 kDa mouse sequence has 98% aa identity with rat, and 95% identity with human, bovine and sheep FGF basic. Autocrine, intracrine and paracrine actions of FGF basic have been identified. Binding of FGF to heparin or cell surface HSPG is necessary for binding, dimerization and activation of tyrosine kinase FGF receptors. FGF basic binds other proteins, polysaccharides and lipids with lower affinity. Expression of FGF basic is nearly ubiquitous but disruption of the mouse FGF basic gene gives a relatively mild phenotype, suggesting compensation by other FGF family members. FGF basic modulates such normal processes as angiogenesis, wound healing and tissue repair, embryonic development and differentiation, neuronal function and neural degeneration. Transgenic overexpression of FGF basic results in excessive proliferation and angiogenesis reminiscent of a variety of pathological conditions.

Available sizes:

No. Size [µg]
300-001 10
300-002 25
300-003 50
300-003-L100 100
300-003-L1000 1000

 

More Information

Size 25 µg
Source E. coli
Biological Activity The ED50 for stimulation of cell proliferation in HDLECs/HUVECs by human FGF-2 (basic) has been determined to be in the range of 0.1-2 ng/mL.
N Terminal Sequence AGSITTL
Purity Confirmation > 98% by SDS-PAGE
Endotoxin < 0.1 ng/µg of protein (< 1 EU/µg)
Length [aa] 153
Molecular Weight 16.5 kDa
Species Reactivity Human, Mouse
Formulation lyophilized
Buffer PBS
Protein Sequence AGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Reconstitution The lyophilized FGF-2 (basic) should be reconstituted in water to a concentration not lower than 50 µg/ml. For long term storage we would recommend to add at least 0.1% human or bovine serum albumin.
Stability and Storage Lyophilized samples are stable for greater than six months at -20°C to -70°C.
Synonyms FGF2; BFGF; FGFB; HBGF-2; basic Fibroblast growth factor (bFGF); Heparin binding growth factor-2
Uniprot ID P09038
Protein RefSeq NP_001997.5
mRNA RefSeq NM_002006.4
Adult stem cells-derived organoids Oral mucosa, Urothelium
Pluripotent stem cells-derived organoids Blood vessel, Cardiac, Esophagus, Liver, Lymph vessel, Skin

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.

All prices plus VAT + possible delivery charges