human DLK-1/Pref-1, soluble protein Human 25 µg

In stock

Cat-Nr.
400-020
Size
25 µg
€214.00

Description / human DLK-1/Pref-1, soluble protein

Delta-like 1 (DLK1), also known as Pref-1 and FA1, is a transmembrane protein pertaining to the epidermal growth factor superfamily. DLK1 affects several differentiation processes, including adipogenesis, muscular and neuronal differentiation, bone differentiation, and haematopoiesis. Several reports support that DLK1 may operate as a non-canonical ligand of the NOTCH pathway. Since the NOTCH signaling pathway is essential for vascular development and physiology by controlling angiogenesis in pre- and post-natal life, it was reasoned that DLK1 could contribute to regulate this process in adult endothelial cells through the interaction with NOTCH receptors. It was found that overexpression of DLK1 inhibits migration and angiotube formation in mammalian vascular endothelial cells and disrupts normal embryonic vascularization in zebrafish. Genetic ablation of DLK1 in mice is associated with increased angiogenesis in vitro and with focal areas of retinal hyper-vascularization. Specific knockdown of the orthologous Dlk1 of zebrafish results in ectopic angiogenesis. Moreover, in a tumor angiogenesis model in zebrafish, suppression of Dlk1 promotes vessel migration towards the tumor cell mass. It was also found that the NOTCH signaling pathway is targeted by DLK1 in the context of angiogenesis and that DLK1 antagonizes NOTCH-dependent signaling in endothelial cells, while, in contrast, this signaling is enhanced in Dlk1-null mice. Collectively, these results revealed a previously unknown role for DLK1 in the vasculature as a regulator of NOTCH-mediated angiogenesis.

Available sizes:

No. Size [µg]
400-020S 5
400-020 25

 

More Information

Size 25 µg
Source E. coli
N Terminal Sequence AECFP
Purity Confirmation > 98% by SDS-PAGE
Length [aa] 282
Molecular Weight 32.2 kDa
Species Reactivity Human
Formulation lyophilized
Buffer PBS
Protein Sequence AECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTSPGCLHGLCGEPGQCICTDGWDGELCDRDVRACSSAPCANNGTCVSLDDGLYECSCAPGYSGKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTCLQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQ
Reconstitution Centrifuge vial prior to opening. Human sDLK1/Pref1 should be reconstituted in water to a concentration of 0.1 mg/ml. This solution can be diluted in water or other buffer solutions or stored at -20°C.
Stability and Storage The lyophilized human sDLK1/Pref1, though stable at room temperature, is best stored desiccated below 0°C. Reconstituted human sDLK1/Pref1 should be stored in working aliquots at -20°C.
Synonyms Protein delta homolog 1, pG2, Fetal antigen 1, FA1, ZOG
Uniprot ID P80370
Protein RefSeq NP_003827.3
mRNA RefSeq NM_003836.5

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.
SKU: 102-PA137
€316.00

In stock

All prices plus VAT + possible delivery charges