human VEGFR-3/FLT-4, soluble protein (His-Tag) Human 10 µg

In stock

Cat-Nr.
S01-017
Size
10 µg
€136.00

Description / human VEGFR-3/FLT-4, soluble protein (His-Tag)

Recombinant human soluble Vascular Endothelial Growth Factor Receptor-3 (sVEGFR-3/FLT-4) was fused with a carboxy-terminal 6X histidine-tag. The recombinant mature sVEGFR-3/FLT-4 is a glycosylated monomeric protein. The sVEGFR-3/FLT-4 monomers have a mass of approximately 120 kDa. The soluble receptor protein consists of all 7 extracellular domains (Met1-Glu774). All three VEGF receptors belong to the class III subfamily of receptor tyrosine kinases (RTKs) characterised by the seven immunoglobulin-like loops in the extracellular domain. The expression of VEGFR-1 to -3 is almost exclusively restricted to hematopoietic precursor cells, vascular and lymphatic endothelial cells and to the monocyte/macrophage lineage. They play key roles in vasculogenesis, hematopoiesis, angiogenesis and lymphangiogenesis. The FLT-4 cDNA encodes a 1298 amino acid (aa) residue precursor protein with a 23aa residue signal peptide. Mature VEGFR-3/FLT-4 is composed of a 751aa residue extracellular domain, a 22aa transmembrane domain and a 482aa residue cytoplasmic domain. Both VEGF family members VEGF-C and VEGF-D have been shown to bind and activate VEGFR-3/FLT-4. The Flt-4 gene is widely expressed in the early embryo but becomes restricted to the lymphatic endothelial a latter stages of development. It is important for lymphangiogenesis.

More Information

Size 10 µg
Source Insect cells
Biological Activity Measured by its ability to bind recombinant rat VEGF-C in a functional solid phase binding assay. Immobilized recombinant human sVEGFR-3/FLT-4 at 5µg/ml can bind recombinant rat VEGF-C in a linear range of 8-500ng/ml
N Terminal Sequence DPSGYSMTPPTLNITEESHV
Purity Confirmation > 90% by SDS-PAGE
Length [aa] 761
Molecular Weight 110 kDa
Species Reactivity Human
Formulation lyophilized
Buffer PBS
Protein Sequence DPSGYSMTPPTLNITEESHVIDTGDSLSISCRGQHPLEWAWPGAQEAPATGDKDSEDTGVVRDCEGTDARPYCKVLLLHEVHANDTGSYVCYYKYIKARIEGTTAASSYVFVRDFEQPFINKPDTLLVNRKDAMWVPCLVSIPGLNVTLRSQSSVLWPDGQEVVWDDRRGMLVSTPLLHDALYLQCETTWGDQDFLSNPFLVHITGNELYDIQLLPRKSLELLVGEKLVLNCTVWAEFNSGVTFDWDYPGKQAER
Reconstitution The lyophilized sVEGFR-3/FLT-4 is soluble in water and most aqueous buffers and should be reconstituted in PBS or medium to a concentration not lower than100 µg/ml.
Stability and Storage Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted sVEGFR-3/FLT-4 should be stored in working aliquots at -20°C. Avoid repeated freeze-thaw cycles!
Synonyms soluble vascular endothelial growth factor receptor-3; FLT4; PCL; LMPH1A; fms-related tyrosine kinase 4
Uniprot ID P35916
Protein RefSeq NP_002011
mRNA RefSeq NM_002020

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.

All prices plus VAT + possible delivery charges