Description / human VEGFR-2/KDR (native), soluble protein
The naturally occuring form of human soluble Endothelial Growth Factor Receptor-2 (sKDR) was cloned from a full length KDR cDNA by standard molecular methods. The soluble receptor protein consists of the first 6 extracellular domains and contains the unique C-terminal end of native human soluble VEGFR-2/KDR (CGRETILDHSAEAVGMP) generated by alternative splicing. The recombinant human sKDR is produced in a monomeric form in insect cells. The receptor monomers have a mass of approximately 105 kDa. Endothelial cells express three different vascular endothelial growth factor (VEGF) receptors, belonging to the family of receptor tyrosine kinases (RTKs). They are named VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1), and VEGFR-3 (Flt-4). For Flt-1 as well as KDR naturally occuring soluble forms are described. The expression of the receptors is almost exclusively restricted to endothelial cells, but VEGFR-1 can also be found on monocytes. All VEGF-receptors have seven immunoglobulin-like extracellular domains, a single transmembrane region and an intracellular split tyrosine kinase domain. VEGFR-2 has a lower affinity for VEGF than the Flt-1 receptor, but a higher signaling activity. Mitogenic activity in endothelial cells is mainly mediated by VEGFR-2 leading to their proliferation. The binding of VEGF165 to VEGFR-2 is dependent on heparin.
More Information
| Size | 5 µg |
|---|---|
| Source | Insect cells |
| Biological Activity | Measured by its ability to inhibit the VEGF165-induced proliferation in human umbilical vein endothelial (HUVE) cells. |
| N Terminal Sequence | ASVGLPSVSL |
| Purity Confirmation | > 95% by SDS-PAGE |
| Length [aa] | 659 |
| Molecular Weight | 105.0 kDa |
| Species Reactivity | Human |
| Formulation | lyophilized |
| Buffer | 25mM MES, 100mM NaCl; pH 5.5 |
| Protein Sequence | ASVGLPSVSLDLPRLSIQKDILTIKANTTLQITCRGQRDLDWLWPNNQSGSEQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQDYRSPFIASVSDQHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWDSKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVVGYRIYDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVN |
| Reconstitution | The lyophilized human sKDR is soluble in water and most aqueous buffers, it should be reconstituted in water or PBS to a concentration of not lower than 100µg/ml. |
| Stability and Storage | The material is stable for greater than six months at -20° C to -70° C. After the first thawing it is recommended to aliquote the material, because repeated freeze-thaw cycles will decrease the activity. Store at 4°C not longer than 2 days. |
| Synonyms | soluble vascular endothelial growth factor receptor-2 ; soluble CD309; soluble VEGF receptor-2; sKDR |
| Uniprot ID | P35968 |
| Protein RefSeq | NP_002244.1 |
| mRNA RefSeq | NM_002253.2 |

