human VEGFR-2/KDR-Fc Chimera, soluble protein Human 50 µg

In stock

Cat-Nr.
SFC-008
Size
50 µg
€214.00

Description / human VEGFR-2/KDR-Fc Chimera, soluble protein

Recombinant human soluble Vascular Endothelial Growth Factor Receptor-2 (sVEGFR-2(D7)) was fused with the Fc part of human IgG1. The recombinant mature sVEGFR-2(D7)/Fc is a disulfide-linked homodimeric protein. The soluble receptor protein consists of all 7 extracellular domains (Met1-Ala757), which contain all the information necessary for high affinity ligand binding. Endothelial cells express three different vascular endothelial growth factor (VEGF) receptors, belonging to the family of receptor tyrosine kinases (RTKs). They are named VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1), and VEGFR-3 (Flt-4). Their expression is almost exclusively restricted to endothelial cells, but VEGFR-1 can also be found on monocytes. All VEGF-receptors have seven immunoglobulin-like extracellular domains, a single transmembrane region and an intracellular split tyrosine kinase domain. VEGFR-2 has a lower affinity for VEGF than the Flt-1 receptor, but a higher signalling activity. Mitogenic activity in endothelial cells is mainly mediated by VEGFR-2 leading to their proliferation. Differential splicing of the flt-1 gene leads to the formation of a secreted, soluble variant of VEGFR-1 (sVEGFR-1). No naturally occurring, secreted forms of VEGFR-2 have so far been reported. The binding of VEGF165 to VEGFR-2 is dependent on heparin.

More Information

Size 50 µg
Source Insect cells
Biological Activity The activity of sVEGFR-2/Fc was determined by its ability to inhibit the VEGF-dependent proliferation of human umbilical vein endothelial cells.
N Terminal Sequence ASVGLPSV
Purity Confirmation > 90% by SDS-PAGE
Length [aa] 968
Molecular Weight 145.0 kDa
Species Reactivity Human
Formulation lyophilized
Buffer PBS; pH 7.2
Protein Sequence ASVGLPSVSLDLPRLSIQKDILTIKANTTLQITCRGQRDLDWLWPNNQSGSEQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQDYRSPFIASVSDQHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWDSKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVVGYRIYDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVN
Reconstitution The lyophilized sVEGFR-2/Fc is soluble in water and most aqueous buffers, it should be reconstituted in water or medium to a concentration not lower than 50 µg/ml.
Stability and Storage Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted sVEGFR-2/Fc should be stored in working aliquots at -20°C. Avoid repeated freeze-thaw cycles!
Synonyms soluble vascular endothelial growth factor receptor-2 ; soluble CD309; soluble VEGF receptor-2; sKDR
Uniprot ID P35968
Protein RefSeq NP_002244.1
mRNA RefSeq NM_002253.2

All prices plus VAT + possible delivery charges