Description / human VEGFR-2/KDR (D7), soluble protein
Recombinant Human soluble Endothelial Growth Factor Receptor-2 (sKDR(D7)) is produced as a non-chimeric protein in a monomeric form. The soluble receptor protein consists of all 7 extracellular domains, which contain all the information necessary for high affinity ligand binding. The receptor monomers have a mass of approximately 116 kDa. Endothelial cells express three different vascular endothelial growth factor (VEGF) receptors, belonging to the family of receptor tyrosine kinases (RTKs). They are named VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1), VEGFR-3 (Flt-4). Their expression is almost exclusively restricted to endothelial cells, but VEGFR-1 can also be found on monocytes. All VEGF-receptors have seven immunoglobulin-like extracellular domains, a single transmembrane region and an intracellular split tyrosine kinase domain. VEGFR-2 has a lower affinity for VEGF than the Flt-1 receptor, but a higher signaling activity. Mitogenic activity in endothelial cells is mainly mediated by VEGFR-2 leading to their proliferation. The binding of VEGF165 to VEGFR-2 is dependent on heparin.
More Information
| Size | 50 µg |
|---|---|
| Source | Insect cells |
| Biological Activity | Measured by its ability to inhibit the VEGF165-induced proliferation in human umbilical vein endothelial (HUVE) cells. |
| N Terminal Sequence | ASVGLPSVSL |
| Purity Confirmation | > 95% by SDS-PAGE |
| Length [aa] | 738 |
| Molecular Weight | 116.0 kDa |
| Species Reactivity | Human |
| Formulation | lyophilized |
| Buffer | 25mM MES, 100mM NaCl; pH 5.5 |
| Protein Sequence | ASVGLPSVSLDLPRLSIQKDILTIKANTTLQITCRGQRDLDWLWPNNQSGSEQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQDYRSPFIASVSDQHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWDSKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVVGYRIYDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVN |
| Reconstitution | The lyophilized human sKDR is soluble in water and most aqueous buffers, it should be reconstituted in water or PBS to a concentration of not lower than 100µg/ml. |
| Stability and Storage | The material is stable for greater than six months at -20° C to -70° C. After the first thawing it is recommended to aliquote the material, because repeated freeze-thaw cycles will decrease the activity. Store at 4°C not longer than 2 days. Avoid repeated |
| Synonyms | soluble vascular endothelial growth factor receptor-2 ; soluble CD309; soluble VEGF receptor-2; sKDR |
| Uniprot ID | P35968 |
| Protein RefSeq | NP_002244.1 |
| mRNA RefSeq | NM_002253.2 |