human VEGFR-1/Flt-1 (native), soluble protein Human 5 µg

In stock

Cat-Nr.
S01-009
Size
5 µg
€88.00

Description / human VEGFR-1/Flt-1 (native), soluble protein

Recombinant human soluble Vascular Endothelial Growth Factor Receptor-1 (sVEGFR-1) is the naturally occurring form and was cloned from total RNA of human umbilical vein endothelial cells. The recombinant mature sVEGFR-1 is a glycosylated monomeric protein with a mass of approximately 96 kDa. The soluble receptor precursor protein consists of the first 6 extracellular domains (Met1-His688) containing the unique 31 amino acids residues at the C-terminus. Endothelial cells express three different vascular endothelial growth factor (VEGF) receptors, belonging to the family of receptor tyrosine kinases (RTKs). They are named VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1), and VEGFR-3 (Flt-4). Their expression is almost exclusively restricted to endothelial cells, but VEGFR-1 can also be found on monocytes, dendritic cells and on trophoblast cells. The flt-1 gene was first described in 1990. The receptor contains seven immunoglobulin-like extracellular domains, a single transmembrane region and an intracellular split tyrosine kinase domain. Compared to VEGFR-2 the Flt-1 receptor has a higher affinity for VEGF but a weaker signaling activity. VEGFR-1 thus leads not to proliferation of endothelial cells, but mediates signals for differentiation. Interestingly, a naturally occurring soluble variant of VEGFR-1 (sVEGFR-1) was found in HUVEC supernatants in 1996, which is generated by alternative splicing of the flt-1 mRNA. The biological functions of sVEGFR-1 still are not clear, but it seems to be an endogenous regulator of angiogenesis, binding VEGF with the same affinity as the full-length receptor.

More Information

Size 5 µg
Source Insect cells
Biological Activity The activity of sVEGFR-1 was determined by its ability to inhibit the VEGF-A-induced proliferation of HUVECs.
N Terminal Sequence SKLKD
Purity Confirmation > 95% by SDS-PAGE
Length [aa] 661
Molecular Weight 96.0 kDa
Species Reactivity Human
Formulation lyophilized
Buffer PBS
Protein Sequence SKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRASVRRR
Reconstitution The lyophilized sVEGFR-1 is soluble in water and most aqueous buffers. The lyophilized sVEGFR-1 should be reconstituted in PBS to a concentration not lower than 100µg/ml.
Stability and Storage Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted sVEGFR-1 should be stored in working aliquots at -70°C. Avoid repeated freeze-thaw cycles!
Synonyms soluble vascular endothelial growth factor receptor-1; soluble FLT1; soluble VEGFR-1
Uniprot ID P17948
Protein RefSeq NP_001153392
mRNA RefSeq NM_001159920

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.

All prices plus VAT + possible delivery charges