mouse VEGF120 protein Mouse 20 µg

In stock

Cat-Nr.
M30-032
Size
20 µg
€214.00

Description / mouse VEGF120 protein

Mouse Vascular Endothelial Growth Factor120 (VEGF120), a 14.1 kDa protein consisting of 120 amino acid residues, is produced as a homodimer. VEGF120 is a polypeptide growth factor and a member of the platelet-derived growth factor family. It is a specific mitogen for vascular endothelial cells and a strong angiogenic factor in vivo. Two high-affinity tyrosine kinase receptors for VEGF120 have been identified, VEGFR-1 (FLT-1), and VEGFR-2 (Flk-1). Consistent with the endothelial cell-specific action of VEGF120, expression of both receptor genes has been found predominantly but not exclusively on endothelial cells. Expression of VEGFR-1 was also found on human monocytes, neutrophils (PMNs), bovine brain pericytes and villous and extravillous trophoblasts. In addition to its action as a mitogen it is a potent vascular permeability factor (VPF) in vivo and is also a chemo attractant for monocytes and endothelial cells. At least four different proteins are generated by differential splicing of the mouse VEGF gene: VEGF120, VEGF144, VEGF164 and VEGF188. The most abundant form is VEGF164. Whereas VEGF120, VEGF144 and VEGF164 are secreted proteins, VEGF188 is strongly cell-associated. In addition, the isoforms VEGF164 and VEGF188 bind to heparin with high affinity. VEGF is apparently a homodimer, but preparations of VEGF show some heterogeneity on SDS gels depending of the secretion of different forms and the varying degrees of glycosylation. All dimeric forms possess similar biological activities. There is evidence that heterodimeric molecules between the different isoforms exists and that different cells and tissues express different VEGF isoforms. A related protein of VEGF is placenta growth factor (PlGF) with about 53% homology and VEGF-B with similar biological activities.

More Information

Size 20 µg
Source E. coli
Biological Activity Measured by cell proliferation of human umbilical vein endothelial cells (HUVEC) in the range of 2-20 ng/ml.
N Terminal Sequence APTTEGE
Purity Confirmation > 90% by SDS-PAGE & silver stain
Length [aa] 120
Molecular Weight 28,2 kDa
Species Reactivity Mouse
Formulation lyophilized
Buffer 50 mM acetic acid
Protein Sequence APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKCDKPRR
Reconstitution The lyophilized VEGF120 should be reconstituted in 50 mM acetic acid to a concentration not lower than 50 µg/ml. For long term storage we recommend to add at least 0.1% human or bovine serum albumin.
Stability and Storage Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted VEGF120 should be stored in working aliquots at -20°C.
Synonyms Vascular Endothelial Growth Factor A; Vegfa; Vpf; Vegf; Vegf120
Uniprot ID Q00731
Protein RefSeq NP_001020421
mRNA RefSeq NM_001025250

All prices plus VAT + possible delivery charges