human VEGF-B167 protein Human 5 µg

In stock

Cat-Nr.
300-080S
Size
5 µg
€88.00

Description / human VEGF-B167 protein

VEGF-B, a member of the VEGF family, is a potent growth and angiogenic cytokine. It promotes DNA synthesis in endothelial cells, helps regulate angiogenesis and vascular permeability, and inhibits apoptosis in certain smooth muscle cells and neurons. VEGF-B is expressed in all tissues except the liver. It forms cell surfaced-associated disulfide linked homodimers and can form heterodimers with VEGF-A. There are two known isoforms, formed by alternative splicing, which have been designated VEGF-B167 and VEGF-B186. Both forms have identical amino-terminal sequences encoding a “cysteine knot” like structural motif, but differ in their carboxyl-terminal domains. Both VEGF-B isoforms signal only through the VEGFR1 receptor. Recombinant human VEGF-B is a 38.0 kDa disulfide-linked homodimeric protein consisting of two 167 amino acid polypeptide chains.

More Information

Size 5 µg
Source E. coli
Biological Activity Measured by its binding ability in a functional ELISA. Immobilized human sVEGFR-1/Flt-1 at 1 µg/mL (100 µL/well) can bind rhVEGF-B167 with a linear range of 0.5 ng/mL to 12.5 ng/mL.
N Terminal Sequence MPVSQ
Purity Confirmation > 98% by SDS-PAGE & Coomassie stain
Length [aa] 167
Molecular Weight 38 kDa
Species Reactivity Human
Formulation lyophilized
Buffer 50mM acetic acid
Protein Sequence MPVSQPDAPGHQRKVVSWIDVYTRATCQPREVVVPLTVELMGTVAKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHSQCECRPKKKDSAVKPDSPRPLCPRCTQHHQRPDPRTCRCRCRRRSFLRCQGRGLELNPDTCRCRKLRR
Reconstitution The lyophilized VEGF-B167 should be reconstituted in water to a concentration not lower than 50 µg/ml. For long term storage we recommend to add at least 0.1% human or bovine serum albumin.
Stability and Storage Lyophilized samples are stable for greater than six months at –20°C to –70°C. Reconstituted VEGF-B167 should be stored in working aliquots at -20°C.
Synonyms vascular endothelial growth factor B; VEGFB; VRF; VEGFL
Uniprot ID P49765
Protein RefSeq NP_003368.1
mRNA RefSeq NM_003377.4

All prices plus VAT + possible delivery charges