human VEGF-B167 protein Human 20 µg

Cat-Nr.
300-080
Size
20 µg
€214.00

Description / human VEGF-B167 protein

VEGF-B, a member of the VEGF family, is a potent growth and angiogenic cytokine. It promotes DNA synthesis in endothelial cells, helps regulate angiogenesis and vascular permeability, and inhibits apoptosis in certain smooth muscle cells and neurons. VEGF-B is expressed in all tissues except the liver. It forms cell surfaced-associated disulfide linked homodimers and can form heterodimers with VEGF-A. There are two known isoforms, formed by alternative splicing, which have been designated VEGF-B167 and VEGF-B186. Both forms have identical amino-terminal sequences encoding a “cysteine knot” like structural motif, but differ in their carboxyl-terminal domains. Both VEGF-B isoforms signal only through the VEGFR1 receptor. Recombinant human VEGF-B is a 38.0 kDa disulfide-linked homodimeric protein consisting of two 167 amino acid polypeptide chains.

Available sizes:

No. Size [µg]
300-080S 5
300-080 20

 

More Information

Size 20 µg
Source E. coli
Biological Activity Measured by its binding ability in a functional ELISA. Immobilized human sVEGFR-1/Flt-1 at 1 µg/mL (100 µL/well) can bind rhVEGF-B167 with a linear range of 0.5 ng/mL to 12.5 ng/mL.
N Terminal Sequence MPVSQ
Purity Confirmation > 98% by SDS-PAGE & Coomassie stain
Endotoxin < 0.1 ng/µg of protein (< 1 EU/µg)
Length [aa] 167
Molecular Weight 38 kDa
Species Reactivity Human
Formulation lyophilized
Buffer 50mM acetic acid
Protein Sequence MPVSQPDAPGHQRKVVSWIDVYTRATCQPREVVVPLTVELMGTVAKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHSQCECRPKKKDSAVKPDSPRPLCPRCTQHHQRPDPRTCRCRCRRRSFLRCQGRGLELNPDTCRCRKLRR
Reconstitution The lyophilized VEGF-B167 should be reconstituted in water to a concentration not lower than 50 µg/ml. For long term storage we recommend to add at least 0.1% human or bovine serum albumin.
Stability and Storage Lyophilized samples are stable for greater than six months at –20°C to –70°C. Reconstituted VEGF-B167 should be stored in working aliquots at -20°C.
Synonyms vascular endothelial growth factor B; VEGFB; VRF; VEGFL
Uniprot ID P49765
Protein RefSeq NP_003368.1
mRNA RefSeq NM_003377.4

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.
SKU: 102-PA72
€316.00

All prices plus VAT + possible delivery charges