mouse VE-Statin/EGFL7 protein (His-Tag) Mouse 20 µg

In stock

Cat-Nr.
M30-100
Size
20 µg
  €136.00

Description / mouse VE-Statin/EGFL7 protein (His-Tag)

EGFL7 is an ∼ 30 kDa secreted protein that contain an Emilin-like (EMI) domain (a multimerization motif), and 2 epidermal growth factor (EGF) domains, one of which binds calcium. Based on these domains, it has been hypothesized that EGFL7 may self-assemble like extracellular matrix (ECM) proteins and, thus, could incorporate into ECM. EGFL7 has been reported to stimulate cell adhesion as well as motility in a manner similar to ECM proteins. EGFL7 has been shown to be primarily expressed by developing ECs but also by primordial germ cells and some central nervous system neurons. Interestingly, EGFL7 expression markedly decreases in ECs in postnatal life, but can be strongly up-regulated after various tissue injuries that lead to increased angiogenic responses.

More Information

Size 20 µg
Source Insect cells
Biological Activity Testing under progress.
Purity Confirmation > 95% by SDS-PAGE
Length [aa] 263
Molecular Weight 28.8 kDa
Species Reactivity Mouse
Formulation lyophilized
Buffer PBS
Protein Sequence YRPSRRVCTVGISGGSISETFVQRVYQPYLTTCDGHRACSTYRTIYRTAYRRSPGVTPARPRYACCPGWKRTSGLPGACGAAICQPPCGNGGSCIRPGHCRCPVGWQGDTCQTDVDECSTGEASCPQRCVNTVGSYWCQGWEGQSPSADGTRCLSKEGPSPVAPNPTAGVDSMAREEVYRLQARVDVLEQKLQLVLAPLHSLASRSTEHGLQDPGSLLAHSFQQLDRIDSLSEQVSFLEEHLGSCSCKKDLHHHH
Reconstitution The lyophilized mouse EGFL7 should be reconstituted in water to a concentration of not lower than 50µg/ml.
Stability and Storage Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted EGFL7 should be stored in working aliquots at -20°C. Avoid repeated freeze-thaw cycles!
Application WB
Synonyms Egfl7; EGF-like domain 7; Zneu1; VE-statin
Uniprot ID Q9QXT5
Protein RefSeq NP_942018.2
mRNA RefSeq NM_198725.2

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.
SKU: 103-PA14
€316.00

In stock

All prices plus VAT + possible delivery charges