mouse TPO protein Mouse 100 µg

In stock

Cat-Nr.
M10-087-L100
Size
100 µg
€941.00

Description / mouse TPO protein

TPO is a lineage specific growth factor, produced in the liver, kidney and skeletal muscle. It stimulates the proliferation and maturation of megakaryocytes, and promotes increased circulating levels of platelets in vivo. TPO signals through the c-mpl receptor and acts as an important regulator of circulating platelets. Human and murine TPO exhibits cross-species reactivity. Recombinant murine TPO is a fully biologically active 174 amino acid polypeptide (18.7 kDa), which contains the erythropoietin-like domain of the full length TPO protein.

More Information

Size 100 µg
Source E. coli
Biological Activity The ED50 as determined by the dose-dependent stimulation of the proliferation of human MO7e cells was found to be < 1.0 ng/ml, corresponding to a specific activity of > 1 x 106 units/mg.
Purity Confirmation > 98% by SDS-PAGE & HPLC analyses
Length [aa] 174
Molecular Weight 18.7 kDa
Species Reactivity Human, Mouse
Formulation lyophilized
Protein Sequence SPVAPACDPRLLNKLLRDSHLLHSRLSQCPDVDPLSIPVLLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQLEPSCLSSLLGQLSGQVRLLLGALQGLLGTQLPLQGRTTAHKDPNALFLSLQQLLRGKVRFLLLVEGPTLCVRRTLPTTAVPSSTSQLLTLNKF
Synonyms TPO, Thrombopoietin, MGDF, Megakaryocyte colony-stimulating factor, c-MPL Ligand
Uniprot ID P40226
Protein RefSeq NP_033405.1
mRNA RefSeq NM_009379.3

All prices plus VAT + possible delivery charges