human TIE-2, soluble protein (His-Tag) Human 10 µg

In stock

Cat-Nr.
S01-043
Size
10 µg
  €136.00

Description / human TIE-2, soluble protein (His-Tag)

Recombinant human soluble TIE-2/TEK was fused with a 6x His-tag at the C-terminus. The soluble receptor protein consists of the full extracellular domain (Thr19-Lys745). TIE-1 (tyrosine kinase with Ig and EGF homology domains 1) and TIE-2/TEK comprise a receptor tyrosine kinase (RTK) subfamily with unique structural characteristics: two immunoglobulin-like domains flanking three epidermal growth factor (EGF)-like domains and followed by three fibronectin type III-like repeats in the extracellular region and a split tyrosine kinase domain in the cytoplasmic region. These receptors are expressed primarily on endothelial and hematopoietic progenitor cells and play critical roles in angiogenesis, vasculogenesis and hematopoiesis. Human TIE-2 cDNA encodes a 1124 amino acid (aa) residue precursor protein with an 18 residue putative signal peptide, a 727 residue extracellular domain and a 354 residue cytoplasmic domain. Two ligands, angiopoietin-1 (Ang1) and angiopoietin-2 (Ang2), which bind TIE-2 with high affinity have been identified. Ang2 has been reported to act as an antagonist for Ang1. Mice engineered to overexpress Ang2 or to lack Ang1 or TIE-2 display similar angiogenic defects.

More Information

Size 10 µg
Source Insect cells
Biological Activity Measured by its ability to bind to immobilized recombinant Ang-2 in a functional ELISA.
N Terminal Sequence AMDLILINSL
Purity Confirmation > 95% by SDS-PAGE
Length [aa] 731
Molecular Weight 95.0 kDa
Species Reactivity Human
Formulation lyophilized
Buffer PBS
Protein Sequence AMDLILINSLPLVSDAETSLTCIASGWRPHEPITIGRDFEALMNQHQDPLEVTQDVTREWAKKVVWKREKASKINGAYFCEGRVRGEAIRIRTMKMRQQASFLPATLTMTVDKGDNVNISFKKVLIKEEDAVIYKNGSFIHSVPRHEVPDILEVHLPHAQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPECNHLCTACMNNGVCHEDTGECICPPGFMGRTCEKACELHTFGRTCKERCSGQEGCKSY
Reconstitution Centrifuge vial prior to opening. The lyophilized sTIE-2-His is soluble in water and most aqueous buffers and should be reconstituted in PBS or medium to a concentration not lower than 50µg/ml.
Stability and Storage Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted sTIE-2-His should be stored in working aliquots at -20°C.
Synonyms TEK; TIE2; VMCM; TIE-2; VMCM1; CD202B
Uniprot ID Q02763
Protein RefSeq NP_000450.2
mRNA RefSeq NM_000459.3

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.
SKU: 101-M50
€193.00

In stock

SKU: 101-M52
€193.00

In stock

SKU: 101-M54
€193.00

In stock

SKU: 101-M55
€453.00

In stock

SKU: 101-M837
€453.00

In stock

SKU: 102-PA111
€316.00

In stock

All prices plus VAT + possible delivery charges