mouse TIE-2/Fc Chimera, soluble protein Mouse 20 µg

In stock

Cat-Nr.
SFC-033
Size
20 µg
€136.00

Description / mouse TIE-2/Fc Chimera, soluble protein

Recombinant murine soluble TIE-2 was fused with the Fc part of human IgG1. The recombinant mature sTIE-2/Fc is a disulfide-linked homodimeric protein. The sTIE-2/Fc monomers have a mass of approximately 105 kDa. As a result of glycosylation, the recombinant protein migrates as an approximately 140 kDa protein in SDS-PAGE under reducing conditions. The soluble receptor protein consists of the full extracellular domain (Val19-Leu740). TIE-1 (tyrosine kinase with Ig and EGF homology domains 1) and TIE-2/Tek comprise a receptor tyrosine kinase (RTK) subfamily with unique structural characteristics: two immunoglobulin-like domains flanking three epidermal growth factor (EGF)-like domains and followed by three fibronectin type III-like repeats in the extracellular region and a split tyrosine kinase domain in the cytoplasmic region. These receptors are expressed primarily on endothelial and hematopoietic progenitor cells and play critical roles in angiogenesis, vasculogenesis and hematopoiesis. Human TIE-1 cDNA encodes a 1122 amino acid (aa) residue precursor protein with an 18 residue putative signal peptide, a 726 residue extracellular domain and a 353 residue cytoplasmic domain. Two ligands, angiopoietin-1 (Ang1) and angiopoietin-2 (Ang2), which bind TIE-2 with high-affinity have been identified. Ang2 has been reported to act as an antagonist for Ang1. Mice engineered to overexpress Ang2 or to lack Ang1 or Tie-1 display similar angiogenic defects.

More Information

Size 20 µg
Source CHO cells
Biological Activity Testing under progress.
Purity Confirmation > 90% by SDS-PAGE
Length [aa] 978
Molecular Weight 280.0 kDa
Species Reactivity Mouse
Formulation lyophilized
Buffer PBS
Protein Sequence GAMDLILINSLPLVSDAETSLTCIASGWHPHEPITIGRDFEALMNQHQDPLEVTQDVTREWAKKVVWKREKASKINGAYFCEGRVRGQAIRIRTMKMRQQASFLPATLTMTVDRGDNVNISFKKVLIKEEDAVIYKNGSFIHSVPRHEVPDILEVHLPHAQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPDCSRPCTTCKNNGVCHEDTGECICPPGFMGRTCEKACEPHTFGRTCKERCSGPEGCKS
Reconstitution Centrifuge vial prior to opening. The lyophilized sTIE-2-His is soluble in water and most aqueous buffers and should be reconstituted in PBS or medium to a concentration not lower than 50µg/ml.
Stability and Storage Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted sTIE-2/hFc should be stored in working aliquots at -20°C.
Synonyms Angiopoietin-1 receptor; Endothelial tyrosine kinase; HYK; STK1; Tunica interna endothelial cell kinase; Tyrosine kinase with Ig and EGF homology domains-2; Tyrosine-protein kinase receptor TEK; Tyrosine-protein kinase receptor TIE-2; p140 TEK; CD202b; Te
Uniprot ID Q02858
Protein RefSeq NP_038718.2
mRNA RefSeq NM_013690.2

All prices plus VAT + possible delivery charges