Description / mouse TIE-1, soluble protein (His-Tag)
Recombinant mouse soluble TIE-1 was fused with a 6x His-tag at the C-terminus. The soluble receptor protein consists of the full extracellular domain (Ser22-Ala748). Mouse sTIE-1 monomer has a calculated molecular mass of approximately 79,8 kDa. As a result of glycosylation, the recombinant protein migrates as an approximately 95 kDa protein in SDS-PAGE under reducing conditions. TIE-1 (tyrosine kinase with Ig and EGF homology domains 1) and TIE-2/Tek comprise a receptor tyrosine kinase (RTK) subfamily with unique structural characteristics: two immunoglobulin-like domains flanking three epidermal growth factor (EGF)-like domains and followed by three fibronectin type III-like repeats in the extracellular region and a split tyrosine kinase domain in the cytoplasmic region. These receptors are expressed primarily on endothelial and hematopoietic progenitor cells and play critical roles in angiogenesis, vasculogenesis and hematopoiesis.
More Information
| Size | 10 µg |
|---|---|
| Source | Insect cells |
| Biological Activity | Data not available. |
| N Terminal Sequence | SVDLTLLANL |
| Purity Confirmation | > 95% by SDS-PAGE |
| Length [aa] | 735 |
| Species Reactivity | Mouse |
| Formulation | lyophilized |
| Buffer | PBS |
| Protein Sequence | SVDLTLLANLRITDPQRFFLTCVSGEAGAGRSSDPPLLLEKDDRIVRTFPPGQPLYLARNGSHQVTLRGFSKPSDLVGVFSCVGGAGARRTRVLYVHNSPGAHLFPDKVTHTVNKGDTAVLSAHVHKEKQTDVIWKNNGSYFNTLDWQEADDGRFQLQLQNVQPPSSGIYSATYLEASPLGSAFFRLIVRGCGAGRWGPGCVKDCPGCLHGGVCHDHDGECVCPPGFTGTRCEQACREGRFGQSCQEQCPGTAGC |
| Reconstitution | Centrifuge vial prior to opening. The lyophilized sTIE-1-His is soluble in water and most aqueous buffers and should be reconstituted in PBS to a concentration not lower than 50µg/ml. |
| Stability and Storage | Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted sTIE-1-His should be stored in working aliquots at -20°C. |
| Synonyms | Tie1; TIE; tie-1; D430008P04Rik |
| Uniprot ID | Q06806 |
| Protein RefSeq | NP_035717.2 |
| mRNA RefSeq | NM_011587.2 |

