mouse TIE-1/Fc Chimera, soluble protein Mouse 100 µg
Description / mouse TIE-1/Fc Chimera, soluble protein
Recombinant murine soluble TIE-1 was fused with the Fc part of human IgG1. The recombinant mature sTIE-1/hFc is a disulfide-linked homodimeric protein. The sTIE-1/hFc monomers have a mass of approximately 105 kDa. As a result of glycosylation, the recombinant protein migrates as an approximately 130 kDa protein in SDS-PAGE under reducing conditions. The soluble receptor protein consists of the full extracellular domain (Val23-Glu749). TIE-1 (tyrosine kinase with Ig and EGF homology domains 1) and TIE-2/Tek comprise a receptor tyrosine kinase (RTK) subfamily with unique structural characteristics: two immunoglobulin-like domains flanking three epidermal growth factor (EGF)-like domains and followed by three fibronectin type III-like repeats in the extracellular region and a split tyrosine kinase domain in the cytoplasmic region. These receptors are expressed primarily on endothelial and hematopoietic progenitor cells and play critical roles in angiogenesis, vasculogenesis and hematopoiesis. Murine TIE-1 cDNA encodes a 1134 amino acid (aa) residue precursor protein with an 22 residue putative signal peptide, a 733 residue extracellular domain and a 354 residue cytoplasmic domain. Whereas two ligands have been described for TIE-2 [angiopoietin-1 (Ang1) and angiopoietin-2 (Ang2)], so far no ligand was found for TIE-1.
More Information
| Size | 100 µg |
|---|---|
| Source | CHO cells |
| Biological Activity | Bioassay data are not available. |
| N Terminal Sequence | VDLTLLANL |
| Purity Confirmation | > 90% by SDS-PAGE |
| Length [aa] | 957 |
| Molecular Weight | 260.0k Da |
| Species Reactivity | Mouse |
| Formulation | lyophilized |
| Buffer | PBS |
| Protein Sequence | VDLTLLANLRITDPQRFFLTCVSGEAGAGRSSDPPLLLEKDDRIVRTFPPGQPLYLARNGSHQVTLRGFSKPSDLVGVFSCVGGAGARRTRVLYVHNSPGAHLFPDKVTHTVNKGDTAVLSAHVHKEKQTDVIWKNNGSYFNTLDWQEADDGRFQLQLQNVQPPSSGIYSATYLEASPLGSAFFRLIVRGCGAGRWGPGCVKDCPGCLHGGVCHDHDGECVCPPGFTGTRCEQACREGRFGQSCQEQCPGTAGCR |
| Reconstitution | Centrifuge vial prior to opening. The lyophilized sTIE-1-His is soluble in water and most aqueous buffers and should be reconstituted in PBS to a concentration not lower than 50µg/ml. |
| Stability and Storage | Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted sTIE-1/Fc should be stored in working aliquots at -20°C. |
| Synonyms | Tie1; TIE; tie-1; D430008P04Rik |
| Uniprot ID | Q06806 |
| Protein RefSeq | NP_035717.2 |
| mRNA RefSeq | NM_011587.2 |

