mouse TIE-1/Fc Chimera, soluble protein Mouse 20 µg

In stock

Cat-Nr.
SFC-031
Size
20 µg
  €136.00

Description / mouse TIE-1/Fc Chimera, soluble protein

Recombinant murine soluble TIE-1 was fused with the Fc part of human IgG1. The recombinant mature sTIE-1/hFc is a disulfide-linked homodimeric protein. The sTIE-1/hFc monomers have a mass of approximately 105 kDa. As a result of glycosylation, the recombinant protein migrates as an approximately 130 kDa protein in SDS-PAGE under reducing conditions. The soluble receptor protein consists of the full extracellular domain (Val23-Glu749). TIE-1 (tyrosine kinase with Ig and EGF homology domains 1) and TIE-2/Tek comprise a receptor tyrosine kinase (RTK) subfamily with unique structural characteristics: two immunoglobulin-like domains flanking three epidermal growth factor (EGF)-like domains and followed by three fibronectin type III-like repeats in the extracellular region and a split tyrosine kinase domain in the cytoplasmic region. These receptors are expressed primarily on endothelial and hematopoietic progenitor cells and play critical roles in angiogenesis, vasculogenesis and hematopoiesis. Murine TIE-1 cDNA encodes a 1134 amino acid (aa) residue precursor protein with an 22 residue putative signal peptide, a 733 residue extracellular domain and a 354 residue cytoplasmic domain. Whereas two ligands have been described for TIE-2 [angiopoietin-1 (Ang1) and angiopoietin-2 (Ang2)], so far no ligand was found for TIE-1.

More Information

Size 20 µg
Source CHO cells
Biological Activity Bioassay data are not available.
N Terminal Sequence VDLTLLANL
Purity Confirmation > 90% by SDS-PAGE
Length [aa] 957
Molecular Weight 260.0k Da
Species Reactivity Mouse
Formulation lyophilized
Buffer PBS
Protein Sequence VDLTLLANLRITDPQRFFLTCVSGEAGAGRSSDPPLLLEKDDRIVRTFPPGQPLYLARNGSHQVTLRGFSKPSDLVGVFSCVGGAGARRTRVLYVHNSPGAHLFPDKVTHTVNKGDTAVLSAHVHKEKQTDVIWKNNGSYFNTLDWQEADDGRFQLQLQNVQPPSSGIYSATYLEASPLGSAFFRLIVRGCGAGRWGPGCVKDCPGCLHGGVCHDHDGECVCPPGFTGTRCEQACREGRFGQSCQEQCPGTAGCR
Reconstitution Centrifuge vial prior to opening. The lyophilized sTIE-1-His is soluble in water and most aqueous buffers and should be reconstituted in PBS to a concentration not lower than 50µg/ml.
Stability and Storage Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted sTIE-1/Fc should be stored in working aliquots at -20°C.
Synonyms Tie1; TIE; tie-1; D430008P04Rik
Uniprot ID Q06806
Protein RefSeq NP_035717.2
mRNA RefSeq NM_011587.2

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.
SKU: 103-PA110
€316.00

In stock

All prices plus VAT + possible delivery charges