human Synuclein alpha protein Human 20 µg
Description / human Synuclein alpha protein
Alpha-Synuclein is a member of the Synuclein family. It is expressed principally in brain but also expressed in low concentrations in all tissues except liver. Alpha synuclein interacts with UCHL1, Phospholipase D and histones. In addition, alpha synuclein is an important regulatory component of vesicular transport in neuronal cells. It has been suggested that alpha synuclein is related to the pathogenesis of Parkinson's Disease and neurodegenerative disorders. Defects in its action will lead to Dementia Lewy Body (DLB).Human Alpha-Synuclein, is also known as Non-A Beta Component of AD Amyloid, Non-A4 Component of Amyloid Precursor, NACP, SNCA, NACP, PARK1. Recombinant Human alpha-Synuclein is produced by our E.coli expression system and the target gene encoding Met1-Ala140 is expressed, and purified as periplasmic protein by ion-exchange chromatography.
More Information
| Size | 20 µg |
|---|---|
| Source | E. coli |
| Biological Activity | Not tested |
| N Terminal Sequence | MDVFMKGLSK |
| Purity Confirmation | >95% as determined by SDS-PAGE |
| Length [aa] | 140 |
| Molecular Weight | 14.4 kDa |
| Protein Sequence | MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA |
| Reconstitution | Always centrifuge tubes before opening. Dissolve the lyophilized protein in ddH2O. Mix gently and do not mix by vortex. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Aliquot the reconstituted solution to minimize freeze-tha |
| Synonyms | Alpha-synuclein, Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor (NACP |
| Uniprot ID | P37840 |
| Protein RefSeq | NP_000336.1 |
| mRNA RefSeq | NM_000345.4 |

