sars-cov-2 Spike-1 RBD protein (His-Tag) SARS-CoV-2 25 µg

Cat-Nr.
400-029
Size
25 µg
€136.00

Description / sars-cov-2 Spike-1 RBD protein (His-Tag)

SARS-CoV2, which causes the global pandemic Corona virus disease 2019 (Covid-19), belongs to a family of viruses known as Corona viruses that are commonly comprised of four structural proteins: Spike protein (S), Envelope protein (E), Membrane protein (M), and Nucleocapsid protein (N). SARS-CoV2 Spike Protein (S Protein) is a glycoprotein that mediates membrane fusion and viral entry. The S protein is homotrimeric, with each ~180-kDa monomer consisting of two subunits, S1 and S2. In SARS-CoV2 proteolytic cleavage of the S protein into two distinct peptides, S1 and S2 subunits, is required for activation. The S1 subunit is focused on attachment of the protein to the host receptor while the S2 subunit is involved with cell fusion. Based on structural biology studies, the receptor binding domain (RBD), located in the C-terminal region of S1, can be oriented either in the up/standing or down/lying state. The standing state is associated with higher pathogenicity and both SARS-CoV-1 and MERS can access this state due to the flexibility in their respective RBDs. A similar two-state structure and flexibility is found in the SARS-CoV2 RBD. Based on amino acid (aa) sequence homology, the SARS-CoV2 S1 subunit RBD has 73% identity with the RBD of the SARS-CoV1 S1 RBD, but only 22% homology with the MERS S1 RBD. The low aa sequence homology is consistent with the finding that SARS and MERS bind different cellular receptors. The S Protein of the SARS-CoV2 virus, like the SARS-CoV1 counterpart, binds Angiotensin-Converting Enzyme 2 (ACE2), but with much higher affinity and faster binding kinetics.

More Information

Size 25 µg
Source Insect cells
Purity Confirmation > 98% by SDS-PAGE & Coomassie
Length [aa] 231
Molecular Weight 36 kDa
Formulation lyophilized
Protein Sequence RVQPTDSIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFTRHHHHHH
Application ELISA
Synonyms S glycoprotein, E2, Peplomer protein
Uniprot ID P0DTC2
Protein RefSeq YP_009724390.1
mRNA RefSeq NC_045512.2

All prices plus VAT + possible delivery charges