mouse SF-20 protein Mouse 100 µg

In stock

Cat-Nr.
M10-092-L100
Size
100 µg
  €1,149.00

Description / mouse SF-20 protein

Mouse SF20 is a bone marrow stroma-derived growth factor. SF20 is expressed in the bone marrow, spleen stroma cells, resting mononuclear cells, resting CD8+ and CD19+ cells and activated CD8+ T cells. SF20 has been shown to bind to the surface of cells expressing the receptor TSA-1 (Thymic shared Ag-1). Among SF20’s biological activities is stimulation of the proliferation of FDCP2 cells (a mouse factor-dependent hemopoietic cell line) and mouse lymphoid cells.

More Information

Size 100 µg
Source E. coli
Biological Activity Data not available.
Purity Confirmation > 98% by SDS-PAGE & HPLC analyses
Length [aa] 143
Molecular Weight 15.8 kDa
Species Reactivity Mouse
Formulation lyophilized
Protein Sequence MVSEPTTVPFDVRPGGVVHSFSQDVGPGNKFTCTFTYASQGGTNEQWQMSLGTSEDSQHFTCTIWRPQGKSYLYFTQFKAELRGAEIEYAMAYSKAAFERESDVPLKSEEFEVTKTAVSHRPGAFKAELSKLVIVAKAARSEL
Synonyms C19orf10; IL25; IL27; SF20; IL27w; R33729_1; EUROIMAGE1875335
Uniprot ID Q9CPT4
Protein RefSeq NP_543027.1
mRNA RefSeq NM_080837.2

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.
SKU: 103-P81
€283.00

In stock

All prices plus VAT + possible delivery charges