mouse SCF protein Mouse 2 µg
Description / mouse SCF protein
Stem cell factor (SCF), also known as ckit ligand (KL), mast cell growth factor (MGF), and steel factor (SLF), is a widely expressed 28-40 kDa type I transmembrane glycoprotein. It promotes the survival, differentiation, and mobilization of multiple cell types including myeloid, erythroid, megakaryocytic, lymphoid, germ cell, and melanocyte progenitors. SCF is a primary growth and activation factor for mast cells and eosinophils. Mature mouse SCF consists of a 189 amino acid (aa) extracellular domain (ECD), a 23 aa transmembrane segment, and a 36 aa cytoplasmic tail. Proteolytic cleavage at two alternate sites in the extracellular juxtamembrane region releases a 25 kDa soluble. An alternately spliced isoform of mouse SCF lacks 28 aa that encompasses the primary proteolytic recognition site. Within the ECD of the short isoform, mouse SCF shares 93% aa sequence identity with rat SCF and 72%-75% with canine, feline, and human SCF. Rat SCF is active on mouse and human cells, but human SCF is only weakly active on mouse cells. Noncovalent dimers of transmembrane or soluble SCF interact with the receptor tyrosine kinase SCF R/ckit to trigger receptor dimerization and signaling.
More Information
| Size | 2 µg |
|---|---|
| Source | E. coli |
| Biological Activity | The ED50 as determined by the dose-dependent stimulation of the proliferation of the human TF-1 cell line is in the range of 2-10 ng/ml. |
| Purity Confirmation | > 95% by SDS-PAGE |
| Length [aa] | 165 |
| Molecular Weight | 18.42 kDa |
| Species Reactivity | Mouse |
| Formulation | lyophilized |
| Buffer | 50 mM aceetic acid |
| Protein Sequence | MKEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA |
| Reconstitution | Centrifuge vial prior to opening. Mouse SCF should be reconstituted in 50mM acetic acid or water to a concentration of 0.1 mg/ml. This solution can be diluted in water or other buffer solutions or stored at -20°C. |
| Stability and Storage | The lyophilized mouse SCF is best stored desiccated below 0°C. Freeze/thaw cycles will result in significant loss of activity. Avoid repeated freeze-thaw cycles. |
| Synonyms | Kitl; Gb; SF; Sl; Clo; Con; Mgf; SCF; SLF; Kitlg; contrasted; mSCF |
| Uniprot ID | P20826 |
| Protein RefSeq | NP_038626.1 |
| mRNA RefSeq | NM_013598.2 |

