mouse SCF protein Mouse 2 µg

In stock

Cat-Nr.
M30-010S
Size
2 µg
€61.00

Description / mouse SCF protein

Stem cell factor (SCF), also known as ckit ligand (KL), mast cell growth factor (MGF), and steel factor (SLF), is a widely expressed 28-40 kDa type I transmembrane glycoprotein. It promotes the survival, differentiation, and mobilization of multiple cell types including myeloid, erythroid, megakaryocytic, lymphoid, germ cell, and melanocyte progenitors. SCF is a primary growth and activation factor for mast cells and eosinophils. Mature mouse SCF consists of a 189 amino acid (aa) extracellular domain (ECD), a 23 aa transmembrane segment, and a 36 aa cytoplasmic tail. Proteolytic cleavage at two alternate sites in the extracellular juxtamembrane region releases a 25 kDa soluble. An alternately spliced isoform of mouse SCF lacks 28 aa that encompasses the primary proteolytic recognition site. Within the ECD of the short isoform, mouse SCF shares 93% aa sequence identity with rat SCF and 72%-75% with canine, feline, and human SCF. Rat SCF is active on mouse and human cells, but human SCF is only weakly active on mouse cells. Noncovalent dimers of transmembrane or soluble SCF interact with the receptor tyrosine kinase SCF R/ckit to trigger receptor dimerization and signaling.

More Information

Size 2 µg
Source E. coli
Biological Activity The ED50 as determined by the dose-dependent stimulation of the proliferation of the human TF-1 cell line is in the range of 2-10 ng/ml.
Purity Confirmation > 95% by SDS-PAGE
Length [aa] 165
Molecular Weight 18.42 kDa
Species Reactivity Mouse
Formulation lyophilized
Buffer 50 mM aceetic acid
Protein Sequence MKEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA
Reconstitution Centrifuge vial prior to opening. Mouse SCF should be reconstituted in 50mM acetic acid or water to a concentration of 0.1 mg/ml. This solution can be diluted in water or other buffer solutions or stored at -20°C.
Stability and Storage The lyophilized mouse SCF is best stored desiccated below 0°C. Freeze/thaw cycles will result in significant loss of activity. Avoid repeated freeze-thaw cycles.
Synonyms Kitl; Gb; SF; Sl; Clo; Con; Mgf; SCF; SLF; Kitlg; contrasted; mSCF
Uniprot ID P20826
Protein RefSeq NP_038626.1
mRNA RefSeq NM_013598.2

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.
SKU: 103-PA08
€316.00

In stock

All prices plus VAT + possible delivery charges