human SCF protein (His-Tag) Human 5 µg

In stock

Cat-Nr.
400-013
Size
5 µg
  €88.00

Description / human SCF protein (His-Tag)

Stem Cell Factor (SCF), a 18.4 kDa protein consisting of 164 amino acid residues (Asp26-Ala189) and fused to a C-terminal His-tag (6x His), is a hematopoietic growth factor that exerts its activity at the early stages of hematopoiesis. SCF stimulates the proliferation of myeloid, erythroid, and lymphoid progenitors in bone marrow cultures and has been shown to act synergistically with colony stimulating factors. This pleiotropic cytokine, alternately known as mast cell growth factor (MGF) and steel-factor (SLF), plays essential roles in gametogenesis, melanogenesis and early stages of hematopoiesis. In vitro and in vivo, SCF can stimulate the proliferation of mature, as well as the proliferation and maturation of immature, mast cells. On purified primitive human and mouse hematopoietic precursors, SCF acts in a synergistic manner with various growth factors, such as IL-1, IL-3, IL-6, IL-7, and Epo , to induce myeloid, erythroid and lymphoid lineage colony formation. The finding that SCF is also expressed in the nervous system suggests a possible role for SCF in the development of the nervous system. The cDNA sequences for human, mouse and rat SCF encode transmembrane proteins which are composed of a signal peptide, a 189 amino acid extracellular domain, a hydrophobic transmembrane domain and an intracellular domain. Native SCF can exist either as the membrane bound form or as a soluble form consisting of the first 164 or 165 amino acids of the extracellular domain. The soluble form is believed to be a proteolytic cleavage product of the transmembrane protein. Both the soluble and the transmembrane form of SCF have growth factor activities. Native soluble SCF is a heavily N- and O-glycosylated protein which exists as a non-covalently associated dimer in solution. All four cysteine residues of SCF monomers are involved in intramolecular disulfide bonds. Murine or rat soluble SCF is highly homologous to human soluble SCF (approximately 80%). Whereas both rat and mouse SCF are active on human cells, the human protein is much less active on mouse or rat cells.

More Information

Size 5 µg
Source Insect cells
Biological Activity Measured in a cell proliferation assay using TF 1 human erythroleukemic cells [Kitamura T et al, J Cell Physiol, 1989]. The ED50 for this effect is typically 1‑5 ng/mL. .
Purity Confirmation > 98% by SDS-PAGE
Length [aa] 173
Molecular Weight 20.0 - 23.0 kDa
Species Reactivity Human
Formulation lyophilized
Buffer PBS
Protein Sequence EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVAASRHHHHHH
Reconstitution Centrifuge vial prior to opening. Human SCF should be reconstituted in water to a concentration of 0.1 mg/ml. This solution can be diluted in water or other buffer solutions or stored at -20°C.
Stability and Storage The lyophilized human SCF, though stable at room temperature, is best stored desiccated below 0°C. Reconstituted human SCF should be stored in working aliquots at -20°C. Avoid repeated freeze-thaw cycles.
Synonyms KITLG; SF; MGF; SCF; FPH2; KL-1; Kitl; SHEP7; kit-ligand
Uniprot ID P21583
Protein RefSeq NP_000890
mRNA RefSeq NM_000899

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.
SKU: 102-P81G
€283.00

In stock

SKU: 101-M621
€453.00

In stock

SKU: 101-M83
€183.00

In stock

SKU: 102-P81
€283.00

In stock

All prices plus VAT + possible delivery charges