human SCF protein Human 10 µg

In stock

Cat-Nr.
100-097
Size
10 µg
  €136.00

Description / human SCF protein

Stem cell factor (SCF), also known as c-kit ligand (KL), mast cell growth factor (MGF), and steel factor (SLF), is a widely expressed 28-40 kDa type I transmembrane glycoprotein. It promotes the survival, differentiation, and mobilization of multiple cell types including myeloid, erythroid, megakaryocytic, lymphoid, germ cell, and melanocyte progenitors. SCF is a primary growth and activation factor for mast cells and eosinophils. Mature mouse SCF consists of a 189 amino acids (aa) extracellular domain (ECD), a 23 aa transmembrane segment, and a 36 aa cytoplasmic tail. The ECD shows both N-linked and O-linked glycosylation. Proteolytic cleavage at two alternate sites in the extracellular juxtamembrane region releases a 25 kDa soluble molecule which is comparable to the only form produced by Steel-dickie mutant mice. An alternatively spliced isoform of mouse SCF lacks 28 aa that encompasses the primary proteolytic recognition site. Within the ECD of the short isoform (corresponding to this recombinant protein), mouse SCF shares 93% aa sequence identity with rat SCF and 72% to 75% with canine, feline, and human SCF. Rat SCF is active on mouse and human cells, but human SCF is only weakly active on mouse cells. Non-covalent dimers of transmembrane or soluble SCF interact with the receptor tyrosine kinase SCF R/c-kit to trigger receptor dimerization and signaling. SCF assists in the recovery of cardiac function following myocardial infarction by increasing the number of cardiomyocytes and vascular channels.

More Information

Size 10 µg
Source E. coli
Biological Activity The ED50 as determined by the dose-dependent stimulation of human TF-1 cells is in the range of 1 - 5 ng/ml. The WHO standard #91/682 was used as a control.
N Terminal Sequence MEGIC
Purity Confirmation > 98% by SDS-PAGE
Length [aa] 165
Molecular Weight 18.5 kDa
Species Reactivity Human
Formulation lyophilized
Buffer PBS
Protein Sequence MEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA
Reconstitution Centrifuge vial prior to opening. Human SCF should be reconstituted in water to a concentration of 0.1 mg/ml. This solution can be further diluted in water or other buffer solutions or stored at -20°C.
Stability and Storage Lyophilized SCF although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution SCF should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a car
Synonyms KITLG; SF; MGF; SCF; FPH2; KL-1; Kitl; SHEP7; kit-ligand; stem cell factor; Mast cell growth factor; c-Kit ligand
Uniprot ID P21583
Protein RefSeq NP_000890
mRNA RefSeq NM_000899

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.
SKU: 102-P81G
€283.00

In stock

SKU: 101-M621
€453.00

In stock

SKU: 101-M83
€183.00

In stock

SKU: 102-P81
€283.00

In stock

All prices plus VAT + possible delivery charges