human RELM beta protein Human 500 µg

In stock

Cat-Nr.
100-279-L500
Size
500 µg
  €1,922.00

Description / human RELM beta protein

Human RELM beta is a 19.0 kDa disulfide-linked homodimeric protein expressed in the epithelium of the colon and small bowel. The biological functions of RELM beta, and its molecular targets, are not fully known but, it has been suggested that it plays a regulatory role during inflammation and may also act to establish links among adipose tissue, the intestine and the liver. Interestingly the molecular structure of RELM beta is highly homologous to that of the adipose-derived cytokine Resistin and RELMa. These proteins share a highly conserved C-terminal domain, characterized by 10 cysteine residues with a unique spacing motif of C-X11-C-X8-C-X-C-X3-C-X10-C-X-C-X-C-X9-C-C. Recombinant human RELM beta is a 19.0 kDa homodimer consisting of two identical 89 amino acid chains linked by a single disulfide bond.

More Information

Size 500 µg
Source E. coli
Biological Activity Data not available.
Purity Confirmation > 98% by SDS-PAGE & HPLC analyses
Length [aa] 89
Molecular Weight 19.0 kDa
Species Reactivity Human
Formulation lyophilized
Protein Sequence MQCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT
Synonyms Resistin-like beta, Cysteine-rich secreted protein FIZZ2
Uniprot ID Q9BQ08
Protein RefSeq NP_115968.1
mRNA RefSeq NM_032579.2

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.
SKU: 102-P249
€271.00

In stock

All prices plus VAT + possible delivery charges