human R-Spondin-1 protein Human 250 µg

In stock

Cat-Nr.
100-130-L250
Size
250 µg
€1,156.00

Description / human R-Spondin-1 protein

R-Spondin-1 (Rspo-1) belongs to the (Rspo) family of Wnt modulators. Currently, the family consists of four structurally related secreted ligands (Rspo 1-4), all containing furin-like and thrombospondin structural domains. Rspo-1 is expressed in certain areas of the developing central nervous system, as well as in adrenal glands, ovary, testis, thyroid, and trachea. Rspo can interact with the Frizzled/LRP6 receptor complex in a manner that stimulates the Wnt/beta-catenin signaling pathway. Recombinant human R-Spondin-1 is a 26.7 kDa protein consisting of 243 amino acid residues.  Due to glycosylation, R-Spondin-1 migrates at an apparent molecular weight of approximately 40.0 kDa by SDS PAGE analysis under reducing conditions.

More Information

Size 250 µg
Source CHO cells
Biological Activity R-spondin-1 enhances BMP-2 mediated differentiation of MC3T3-E1 cells. The expected ED50 is 1.0-3.0 ug/ml.
Purity Confirmation > 95% by SDS-PAGE & HPLC analyses
Length [aa] 243
Molecular Weight 26.7 kDa
Species Reactivity Human
Formulation lyophilized
Protein Sequence SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA
Synonyms Roof plate-specific Spondin, Rspo1
Uniprot ID Q2MKA7
Protein RefSeq NP_001033722.1
mRNA RefSeq NM_001038633.3
Adult stem cells-derived organoids Endometrium, Fallopian tube, Gallbladder, Intestine, Kidney tubule, Liver, Mammary, Oesophagus, Oral mucosa, Pancreatic duct, Stomach
Pluripotent stem cells-derived organoids Intestine

All prices plus VAT + possible delivery charges