human R-Spondin-1 protein Human 5 µg
Description / human R-Spondin-1 protein
R-Spondin-1 (Rspo-1) belongs to the (Rspo) family of Wnt modulators. Currently, the family consists of four structurally related secreted ligands (Rspo 1-4), all containing furin-like and thrombospondin structural domains. Rspo-1 is expressed in certain areas of the developing central nervous system, as well as in adrenal glands, ovary, testis, thyroid, and trachea. Rspo can interact with the Frizzled/LRP6 receptor complex in a manner that stimulates the Wnt/beta-catenin signaling pathway. Recombinant human R-Spondin-1 is a 26.7 kDa protein consisting of 243 amino acid residues. Due to glycosylation, R-Spondin-1 migrates at an apparent molecular weight of approximately 40.0 kDa by SDS PAGE analysis under reducing conditions.
More Information
| Size | 5 µg |
|---|---|
| Source | CHO cells |
| Biological Activity | R-spondin-1 enhances BMP-2 mediated differentiation of MC3T3-E1 cells. The expected ED50 is 1.0-3.0 ug/ml. |
| Purity Confirmation | > 95% by SDS-PAGE & HPLC analyses |
| Length [aa] | 243 |
| Molecular Weight | 26.7 kDa |
| Species Reactivity | Human |
| Formulation | lyophilized |
| Protein Sequence | SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA |
| Synonyms | Roof plate-specific Spondin, Rspo1 |
| Uniprot ID | Q2MKA7 |
| Protein RefSeq | NP_001033722.1 |
| mRNA RefSeq | NM_001038633.3 |
| Adult stem cells-derived organoids | Endometrium, Fallopian tube, Gallbladder, Intestine, Kidney tubule, Liver, Mammary, Oesophagus, Oral mucosa, Pancreatic duct, Stomach |
| Pluripotent stem cells-derived organoids | Intestine |

