human PTHrP protein Human 100 µg
Description / human PTHrP protein
PTHrP is a polypeptide hormone produced by almost every tissue of the body. PTHrP is closely related to parathyroid hormone (PTH), which is secreted from the parathyroid gland, and plays a central role in regulating the extracellular concentrations of calcium and phosphorous. Recombinant human PTHrP is a 9.8 kDa linear polypeptide of 86 amino acid residues.
More Information
| Size | 100 µg |
|---|---|
| Source | E. coli |
| Biological Activity | Data not available. |
| Purity Confirmation | > 98% by SDS-PAGE & HPLC analyses |
| Length [aa] | 86 |
| Molecular Weight | 9.8 kDa |
| Species Reactivity | Human |
| Formulation | lyophilized |
| Protein Sequence | AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTP |
| Synonyms | Parathyroid Hormone-related Protein |
| Uniprot ID | P12272 |
| Protein RefSeq | NP_002811.1 |
| mRNA RefSeq | NM_002820.2 |

