human PTHrP protein Human 50 µg

In stock

Cat-Nr.
100-275
Size
50 µg
€217.00

Description / human PTHrP protein

PTHrP is a polypeptide hormone produced by almost every tissue of the body. PTHrP is closely related to parathyroid hormone (PTH), which is secreted from the parathyroid gland, and plays a central role in regulating the extracellular concentrations of calcium and phosphorous. Recombinant human PTHrP is a 9.8 kDa linear polypeptide of 86 amino acid residues.

More Information

Size 50 µg
Source E. coli
Biological Activity Data not available.
Purity Confirmation > 98% by SDS-PAGE & HPLC analyses
Length [aa] 86
Molecular Weight 9.8 kDa
Species Reactivity Human
Formulation lyophilized
Protein Sequence AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTP
Synonyms Parathyroid Hormone-related Protein
Uniprot ID P12272
Protein RefSeq NP_002811.1
mRNA RefSeq NM_002820.2

All prices plus VAT + possible delivery charges