human Prox-1 (fragment) protein Human 5 µg

In stock

Cat-Nr.
300-052
Size
5 µg
  €88.00

Description / human Prox-1 (fragment) protein

Prox-1 is a homeobox gene and acts as a master switch for lymphatic endothelial phenotype. Expression of Prox-1 in blood endothelial cells induces expression of other lymphatic marker genes. Together with Podoplanin, Prox-1 can be used to reliably distinguish lympathic vessels from blood vessels. Prox1 is expressed in CNS, eye, pancreas, liver and heart, and it is one of the most specific and reliable markers for lymphatic endothelial cells. The highly conserved C-terminal part of the homeobox transcription factor Prox1 was produced in E. coli. It was not tested for activity and can be used as positive control e.g. in Western analysis.

More Information

Size 5 µg
Source E. coli
Biological Activity Control for Western Blotting. Biological activity not tested.
Purity Confirmation > 95% by SDS-PAGE
Length [aa] 192
Molecular Weight 22.35 kDa
Species Reactivity Human
Formulation lyophilized
Buffer PBS
Protein Sequence MAEGLSLSLIKSECGDLQDMSEISPYSGSAMQEGLSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQELLHE
Reconstitution Centrifuge vial prior to opening. The lyophilized Prox-1 should be reconstituted in water to a concentration not lower than 50 µg/ml.
Stability and Storage The lyophilized protein is stable for a few weeks at room temperature, but best stored at –20°C. Reconstituted Prox-1 should be stored in working aliquots at –20°C. Avoid repeated freeze-thaw cycles.
Synonyms PROX1; W117m
Uniprot ID Q92786
Protein RefSeq NP_002754
mRNA RefSeq NM_002763

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.
SKU: 102-PA32
€316.00

In stock

SKU: 102-PA32AG
€193.00

In stock

All prices plus VAT + possible delivery charges