rat Prolactin Receptor, soluble protein Rat 20 µg

Cat-Nr.
500-082
Size
20 µg
€255.00

Description / rat Prolactin Receptor, soluble protein

Prolactin is a pituitary hormone involved in the stimulation of milk production, salt and water regulation, growth, development and reproduction. The initial step in its action is the binding to a specific membrane receptor (prolactin receptor) which belongs to the superfamily of class 1 cytokine receptors. Prolactin (PRL) is a hormone involved in a variety of important functions including ion transport and osmoregulation, stimulation of milk, protein synthesis as well as the regulation of numerous reproductive functions. PRL exerts its influence on different cell types through a signal transduction pathway which begins with the binding of the hormone to a transmembrane PRL receptor. PRL receptor, varies in size (short and long forms) with tissue source and species, from ~40 kDa to 100 kDa. The PRL receptor consists of at least three separate domains: an extracellular region with 5 cysteines which contains the prolactin binding site, a single transmembrane domain and a cytoplasmic region, the length of which appears to influence ligand binding and regulate cellular function. Recombinant rabbit Prolactin Receptor Extra Cellular Domain (rbPRLR-ECD) produced in E.Coli is a non-glycosylated, polypeptide chain containing 206 amino acids and having a molecular mass of 24120 Da was prepared according to Sandowski et al. (1995) Mol. Cell. Endocrinol. 269; 3318-24 and tested according to Gertler et al. (1996) JBC 271; 24482-91.

More Information

Size 20 µg
Source E. coli
Biological Activity Activity is determined by the dose-dependant inhibition of PRL-stimuled proliferation of Nb2 cells and by high affinity binding of PRL and other lactogenic hormones.
N Terminal Sequence GKPEI
Purity Confirmation > 97% by SDS-PAGE & HPLC analyses
Length [aa] 206
Molecular Weight 24.1 kDa
Species Reactivity Rat
Formulation lyophilized
Protein Sequence GKPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYSKEGEKTTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVTYIVEPEPPRNLTLEVKQLKDKKTYLWVKWSPPTITDVKTGWFTMEYEIRLKPEEAEEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWSQESSVEMPNDFTLKD
Reconstitution It is recommended to reconstitute the lyophilized PRLR-ECD in sterile 18M-cm H2O not less than 100µg/ml and not more than 1 mg/ml, which can then be further diluted to other aqueous solutions containinh carrier protein such as BSA or HSA.
Synonyms Mammotropin, Luterotropic hormone, Lutetropin
Uniprot ID P05710
Protein RefSeq NP_001029283.1
mRNA RefSeq NM_001034111.1

All prices plus VAT + possible delivery charges