ovine Prolactin antagonist (G129R) protein Ovine 1000 µg

In stock

Cat-Nr.
500-086-L1000
Size
1000 µg
  €1,203.00

Description / ovine Prolactin antagonist (G129R) protein

Recombinant ovine prolactin, G129R mutein is one polypeptide chain containing 199 amino and an additional Ala at N-terminus acids and having a molecular mass of ~ 23 kDa, was purified by proprietary chromatographic techniques (no published information). It is available in two forms: as full size protein and it its DEL 9 aa truncated form from its N-terminus which has higher inhibitory activity.

More Information

Size 1000 µg
Source E. coli
Biological Activity Recombinant oPRL G129R is devoid of agonistic activity and capable of inhibiting biological activity of oPRL or other lactogenic hormones as evidenced by proliferation assay of Nb2 or other cells. The truncated form is more potent inhibitor.
N Terminal Sequence ATPVCP
Purity Confirmation > 99% by SDS-PAGE & HPLC analyses
Length [aa] 199
Molecular Weight 23.0 kDa
Species Reactivity Ovine
Formulation lyophilized
Protein Sequence ATPVCPNGPGNCQVSLRDLFDRAVMVSHYIHNLSSEMFNEFDKRYAQGKGFITMALNSCHTSSLPTPEDKEQAQQTHHEVLMSLILGLLRSWNDPLYHLVTEVRGMKGVPDAILSRAIEIEEENKRLLERMEMIFGQVIPGAKETEPYPVWSGLPSLQTKDEDARHSAFYNLLHCLRRDSSKIDTYLKLLNCRIIYNNNC
Reconstitution It is recommended to reconstitute the lyophilized oPRL G129R in sterile water or 0.4% NaHCO3 adjusted tp pH 8-9, not less than 100µg/ml, which can then be further diluted to other aqueous solutions, preferably in presence of carrier protein.
Synonyms Mammotropin, Luterotropic hormone, Lutetropin
Uniprot ID P01240
Protein RefSeq NP_001009306.1
mRNA RefSeq NM_001009306.1

All prices plus VAT + possible delivery charges