rabbit Prolactin protein Rabbit 1000 µg
Description / rabbit Prolactin protein
Recombinant rabbit prolactin, one polypeptide chain containing 199 amino and an additional Ala at N-terminus acids and having a molecular mass of ~ 23 kDa, was purified by proprietary chromatographic techniques (unpublished data).
More Information
| Size | 1000 µg |
|---|---|
| Source | E. coli |
| Biological Activity | Recombinynt rbPRL is fully biologically active as evidenced by inducing proliferation of Nb2 cells and Baf3 cells stably transfected with rabbit prolactin receptor, algough its relative activity as compared to human prolactin is respectively 8-fold and 4- |
| N Terminal Sequence | APICP |
| Purity Confirmation | > 98% by SDS-PAGE & HPLC analyses |
| Length [aa] | 199 |
| Molecular Weight | 23.0 kDa |
| Species Reactivity | Rabbit |
| Formulation | lyophilized |
| Protein Sequence | APICPSGAVNCQVSLRDLFDRAVILSHHIHKLSSEMFNEFDKRYTQGRGFITKAINSCHTSSLSTPEDKEQAQQIHHEDLLNMVLRVLPSWNDPLYHLVTEVRGMQEAPDAILSKAIEIEEQNRRLLEGMEKIVGQVHPGIKENEIYSVWSGLPSLQMADEDARLFAFYNLLHCLRRDSHKIDNYLKLLKCRIIYDSNC |
| Reconstitution | It is recommended to reconstitute the lyophilized rbPRL in sterile 0.04% NaHCO3 adjusted, not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
| Synonyms | Mammotropin, Luterotropic hormone, Lutetropin |
| Uniprot ID | Q28632 |
| Protein RefSeq | NP_001076144.1 |
| mRNA RefSeq | NM_001082675.1 |

