rabbit Prolactin protein Rabbit 1000 µg

In stock

Cat-Nr.
500-088-L1000
Size
1000 µg
  €1,688.00

Description / rabbit Prolactin protein

Recombinant rabbit prolactin, one polypeptide chain containing 199 amino and an additional Ala at N-terminus acids and having a molecular mass of ~ 23 kDa, was purified by proprietary chromatographic techniques (unpublished data).

More Information

Size 1000 µg
Source E. coli
Biological Activity Recombinynt rbPRL is fully biologically active as evidenced by inducing proliferation of Nb2 cells and Baf3 cells stably transfected with rabbit prolactin receptor, algough its relative activity as compared to human prolactin is respectively 8-fold and 4-
N Terminal Sequence APICP
Purity Confirmation > 98% by SDS-PAGE & HPLC analyses
Length [aa] 199
Molecular Weight 23.0 kDa
Species Reactivity Rabbit
Formulation lyophilized
Protein Sequence APICPSGAVNCQVSLRDLFDRAVILSHHIHKLSSEMFNEFDKRYTQGRGFITKAINSCHTSSLSTPEDKEQAQQIHHEDLLNMVLRVLPSWNDPLYHLVTEVRGMQEAPDAILSKAIEIEEQNRRLLEGMEKIVGQVHPGIKENEIYSVWSGLPSLQMADEDARLFAFYNLLHCLRRDSHKIDNYLKLLKCRIIYDSNC
Reconstitution It is recommended to reconstitute the lyophilized rbPRL in sterile 0.04% NaHCO3 adjusted, not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Synonyms Mammotropin, Luterotropic hormone, Lutetropin
Uniprot ID Q28632
Protein RefSeq NP_001076144.1
mRNA RefSeq NM_001082675.1

All prices plus VAT + possible delivery charges