ovine Prolactin protein Ovine 1000 µg

In stock

Cat-Nr.
500-085-L1000
Size
1000 µg
  €2,407.00

Description / ovine Prolactin protein

Recombinant ovine prolactin, one polypeptide chain containing 199 amino and an additional Ala at N-terminus acids and having a molecular mass of ~ 23 kDa, was purified by proprietary chromatographic techniques (see Leibovich et al., Protein Expr Purif. 2001 22:489-96).

More Information

Size 1000 µg
Source E. coli
Biological Activity Recombinant oPRL is fully biologically active as evidenced by inducing proliferation of Nb2 cells.
N Terminal Sequence ATPVCP
Purity Confirmation > 99% by SDS-PAGE & HPLC analyses
Length [aa] 199
Molecular Weight 23.0 kDa
Species Reactivity Ovine
Formulation lyophilized
Protein Sequence ATPVCPNGPGNCQVSLRDLFDRAVMVSHYIHNLSSEMFNEFDKRYAQGKGFITMALNSCHTSSLPTPEDKEQAQQTHHEVLMSLILGLLRSWNDPLYHLVTEVRGMKGVPDAILSRAIEIEEENKRLLEGMEMIFGQVIPGAKETEPYPVWSGLPSLQTKDEDARHSAFYNLLHCLRRDSSKIDTYLKLLNCRIIYNNNC
Reconstitution It is recommended to reconstitute the lyophilized oPRL in sterile water or 0.4% NaHCO3 adjusted tp pH 8-9, not less than 100µg/ml, which can then be further diluted to other aqueous solutions, preferably in presence of carrier protein.
Synonyms Mammotropin, Luterotropic hormone, Lutetropin
Uniprot ID P01240
Protein RefSeq NP_001009306.1
mRNA RefSeq NM_001009306.1

All prices plus VAT + possible delivery charges