Description / ovine Prolactin protein
Recombinant ovine prolactin, one polypeptide chain containing 199 amino and an additional Ala at N-terminus acids and having a molecular mass of ~ 23 kDa, was purified by proprietary chromatographic techniques (see Leibovich et al., Protein Expr Purif. 2001 22:489-96).
More Information
| Size | 5 µg |
|---|---|
| Source | E. coli |
| Biological Activity | Recombinant oPRL is fully biologically active as evidenced by inducing proliferation of Nb2 cells. |
| N Terminal Sequence | ATPVCP |
| Purity Confirmation | > 99% by SDS-PAGE & HPLC analyses |
| Length [aa] | 199 |
| Molecular Weight | 23.0 kDa |
| Species Reactivity | Ovine |
| Formulation | lyophilized |
| Protein Sequence | ATPVCPNGPGNCQVSLRDLFDRAVMVSHYIHNLSSEMFNEFDKRYAQGKGFITMALNSCHTSSLPTPEDKEQAQQTHHEVLMSLILGLLRSWNDPLYHLVTEVRGMKGVPDAILSRAIEIEEENKRLLEGMEMIFGQVIPGAKETEPYPVWSGLPSLQTKDEDARHSAFYNLLHCLRRDSSKIDTYLKLLNCRIIYNNNC |
| Reconstitution | It is recommended to reconstitute the lyophilized oPRL in sterile water or 0.4% NaHCO3 adjusted tp pH 8-9, not less than 100µg/ml, which can then be further diluted to other aqueous solutions, preferably in presence of carrier protein. |
| Synonyms | Mammotropin, Luterotropic hormone, Lutetropin |
| Uniprot ID | P01240 |
| Protein RefSeq | NP_001009306.1 |
| mRNA RefSeq | NM_001009306.1 |