human PRAME protein Human 20 µg

In stock

Cat-Nr.
400-016
Size
20 µg
  €136.00

Description / human PRAME protein

PRAME/MAPE/OIP4 is a germinal tissue-specific gene that is also expressed at high levels in haematological malignancies and solid tumors. The physiological functions of PRAME in normal and tumor cells are unknown, although a role in the regulation of retinoic acid signaling has been proposed. Sequence homology and structural predictions suggest that PRAME is related to the Leucine-rich repeat (LRR) family of proteins, which have diverse functions. PRAME, or „preferentially expressed antigen in melanoma”, was originally identified as a gene encoding a HLA-A24 restricted antigenic peptide presented to autologous tumor-specific cytotoxic T lymphocytes derived from a patient with melanoma. PRAME is synonymous with MAPE (melanoma antigen preferentially expressed in tumors) and OIP4 (OPA-interacting protein 4), and its expression profile defines it as a cancer-testis antigen. Cancer-testis antigens (CTAs) are encoded by non-mutated genes expressed at high levels in germinal tissues and tumors, but which are absent from or detected at low levels in other tissues. PRAME may be somewhat different to other cancer-testis antigens in that it shows some expression in normal tissues such as ovary, adrenal, placenta and endometrium. The C-terminus of human PRAME (amino acids 453-509) was also identified to bind Neisseria gonorrhoeae opacity factors, in this case the OPA-P protein. Thus PRAME is also known as OIP4 (OPA interacting protein), although the functional implications of the interaction are unknown.

More Information

Size 20 µg
Source E. coli
Biological Activity Positive control for WB.
Purity Confirmation > 98 by SDS-PAGE
Length [aa] 100
Molecular Weight 10.7 kDa
Species Reactivity Human
Formulation lyophilized
Buffer 10mM Tris, 25 mM NaP, pH 7.4
Protein Sequence MNPLETLSITNCRLSEGDVMHLSQSPSVSQLSVLSLSGVMLTDVSPEPLQALLERASATLQDLVFDECGITDDQLLALLPSLSHCSQLTTLSFYGNSISI
Reconstitution Centrifuge vial prior to opening. Human PRAME should be reconstituted in water to a concentration of 0.1 mg/ml. This solution can be diluted in water or other buffer solutions or stored at -20°C
Stability and Storage The lyophilized human PRAME, though stable at room temperature, is best stored desiccated below 0°C. Reconstituted human PRAME should be stored in working aliquots at -20°C.
Synonyms Melanoma antigen preferentially expressed in tumors; Opa-interacting protein 4; MAPE, OIP4
Uniprot ID P78395
Protein RefSeq NP_006106.1
mRNA RefSeq NM_006115.3

Compatible products

Navigating through the elements of the carousel is possible using the tab key. You can skip the carousel or go straight to carousel navigation using the skip links.
SKU: 102-PA28
€316.00

In stock

All prices plus VAT + possible delivery charges