mouse PlGF protein Mouse 2 µg
Description / mouse PlGF protein
Placenta growth factor (PlGF) is a member of the vascular endothelial growth factor (VEGF) family of growth factors. PlGF and VEGF share primary structural as well as limited amino acid sequence homology with the A and B chains of PDGF. All eight cysteine residues involved in intra and interchain disulfides are conserved among these growth factors. As a result of alternative splicing, three PlGF RNAs encoding monomeric human PlGF-1, PlGF-2 and PlGF-3 isoform precursors containing 149, 179 and 219 amino acid residues, respectively, have been described. In normal mouse tissues, only one mouse PlGF mRNA encoding the equivalent of human PlGF-2 has been identified. Mouse PlGF shares 65% amino acid identity with human PlGF-2. The gene for PlGF has been mapped to mouse chromosome 12 and human chromosome 14. PlGF binds with high affinity to Flt1, but not to Flk1/KDR.
More Information
| Size | 2 µg |
|---|---|
| Source | Insect cells |
| Biological Activity | Measured by its ability to bind to immobilized rh-sFlt-1 in a functional ELISA. Recombinant mouse PlGF can bind to immobilized rh-sFlt-1 (100 ng/well) with a linear range at 0.5 - 10 ng/mL. |
| N Terminal Sequence | ALSAGNNSTE and AGNNSTE |
| Purity Confirmation | > 95% by SDS-PAGE |
| Length [aa] | 135/132 |
| Molecular Weight | ~40 kDa |
| Species Reactivity | Mouse |
| Formulation | lyophilized |
| Buffer | 25 mM Tris, 75 mM NaCl pH 8.5 |
| Protein Sequence | ALSAGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDEYPDEVSHIFSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMTFSQDVLCECRPILETTKAERRKTKGKRKRSRNSQTEEPHP |
| Reconstitution | Centrifuge vial prior to opening. The lyophilised PlGF is supplied in lyophilized form with carrier-protein (BSA) and can be reconstituted with 50mM acetic acid or PBS/water. This solution can be diluted into other buffered solutions or stored frozen for |
| Stability and Storage | The lyophilized mouse PIGF, though stable at room temperature, is best stored in working aliquots at -20°C to -70°C. |
| Synonyms | Pgf; PlGF; Plgf; AI854365; placental growth factor |
| Uniprot ID | P49764 |
| Protein RefSeq | NP_032853 |
| mRNA RefSeq | NM_008827 |

