mouse PlGF protein Mouse 5 µg
Description / mouse PlGF protein
Placenta growth factor (PlGF) is a member of the vascular endothelial growth factor (VEGF) family of growth factors. PlGF and VEGF share primary structural as well as limited amino acid sequence homology with the A and B chains of PDGF. All eight cysteine residues involved in intra and interchain disulfides are conserved among these growth factors. As a result of alternative splicing, three PlGF RNAs encoding monomeric human PlGF1, PlGF2 and PlGF3 isoform precursors containing 149, 179 and 219 amino acid residues, respectively, have been described. In normal mouse tissues, only one mouse PlGF mRNA encoding the equivalent of human PlGF2 has been identified. Mouse PlGF shares 65% amino acid identity with human PlGF2. The gene for PlGF has been mapped to mouse chromosome 12 and human chromosome 14. PlGF binds with high affinity to Flt1, but not to Flk1/KDR.
More Information
| Size | 5 µg |
|---|---|
| Source | Insect cells |
| Biological Activity | Measured by its ability to bind to immobilized rh-sFlt-1 in a functional ELISA. Recombinant mouse PlGF can bind to immobilized rh-sFlt-1 (100 ng/well) with a linear range at 0.5 - 10 ng/mL. |
| N Terminal Sequence | ALSAGNNSTE and AGNNSTE |
| Purity Confirmation | > 95% by SDS-PAGE |
| Length [aa] | 135/132 |
| Molecular Weight | ~40 kDa |
| Species Reactivity | Mouse |
| Formulation | lyophilized |
| Buffer | 25 mM Tris, 75 mM NaCl pH 8.5 |
| Protein Sequence | ALSAGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDEYPDEVSHIFSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMTFSQDVLCECRPILETTKAERRKTKGKRKRSRNSQTEEPHP |
| Reconstitution | Centrifuge vial prior to opening. The lyophilised PlGF is supplied in lyophilized form with carrier-protein (BSA) and can be reconstituted with 50mM acetic acid or PBS/water. This solution can be diluted into other buffered solutions or stored frozen for |
| Stability and Storage | The lyophilized mouse PIGF, though stable at room temperature, is best stored in working aliquots at -20°C to -70°C. |
| Synonyms | Pgf; PlGF; Plgf; AI854365 |
| Uniprot ID | P49764 |
| Protein RefSeq | NP_032853 |
| mRNA RefSeq | NM_008827 |

